KEGG   Schizosaccharomyces pombe (fission yeast): SPCC794.07Help
Entry
SPCC794.07        CDS       T00076                                 

Gene name
lat1
Definition
dihydrolipoamide S-acetyltransferase E2, Lat1 (predicted) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPCC794.07 (lat1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCC794.07 (lat1)
   00020 Citrate cycle (TCA cycle)
    SPCC794.07 (lat1)
   00620 Pyruvate metabolism
    SPCC794.07 (lat1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPCC794.07 (lat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:join(262811..262884,262971..263041,263093..264399)
Genome map
AA seq 483 aa AA seqDB search
MLSANMLRRMHHGVAVTRMLLVSNGKVQVKKSALYPVMAKLARTYATKNYPAHTVINMPA
LSPTMTTGNIGAFQKKIGDKIEPGDVLCEIETDKAQIDFEQQDEGYLAKILIETGTKDVP
VGKPLAVTVENEGDVAAMADFTIEDSSAKEPSAKSGEEKSAPSSEKQSKETSSPSNVSGE
ERGDRVFASPLARKLAEEKDLDLSQIRGSGPNGRIIKVDIENFKPVVAPKPSNEAAAKAT
TPAASAADAAAPGDYEDLPLSNMRKIIASRLAESKNMNPHYYVTVSVNMEKIIRLRAALN
AMADGRYKLSVNDLVIKATTAALRQVPEVNAAWMGDFIRQYKNVDISMAVATPSGLITPV
IRNTHALGLAEISTLAKDYGQRARNNKLKPEEYQGGTFTISNLGMFPVDQFTAIINPPQA
CILAVGTTVDTVVPDSTSEKGFKVAPIMKCTLSSDHRVVDGAMAARFTTALKKILENPLE
IML
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgctatcagcaaatatgcttcgtcgtatgcaccatggtgttgctgtaactagaatgctg
cttgtttcgaatggaaaagttcaggttaaaaagtctgctctttatcctgttatggctaag
ctagctcgcacatacgctaccaaaaactatcctgctcataccgtgattaacatgcccgct
ttgtctccgactatgactactggcaatattggagcattccaaaagaaaattggagacaaa
attgaacctggcgatgttttgtgtgagattgaaacggataaggcccagattgactttgaa
caacaggacgagggctaccttgcaaaaattttgattgaaactggcactaaggatgttcct
gttggcaagcccttagctgttacagtcgaaaatgaaggagacgttgccgctatggctgat
ttcaccattgaggattcgtctgccaaggaaccctcagctaagagcggtgaagaaaagtcg
gctccttctagcgagaaacaatcaaaagagacctctagcccatctaatgtttctggcgaa
gaacgcggtgatcgcgtttttgcttcacctctggctcgcaagttggccgaagagaaggat
cttgacttatcccaaattcgcggctcaggtcccaatggacgtattattaaggtcgatatt
gaaaactttaaacctgtggtcgcacctaaaccttcaaatgaggctgctgctaaagctaca
actcctgctgcctccgctgccgacgcagcagcacctggtgactatgaagatcttccttta
agcaacatgcgtaagatcattgcttctcgtcttgcagaaagtaaaaacatgaaccctcat
tactacgttacggtctcggttaacatggaaaaaatcattcgcctccgtgctgccctcaac
gccatggctgatggacgctataagctttcggttaacgaccttgttatcaaagctactact
gctgctttgaggcaagttcccgaagttaatgcggcttggatgggtgactttattcgtcaa
tataagaacgtcgatatttctatggctgttgctacaccttctggtttaatcactcctgta
attcgcaatactcatgcactcggtcttgcagaaatttccactttagctaaggattatggc
caacgtgcccgtaacaacaaattgaagcctgaggaatatcaaggaggcacattcaccatc
tctaatttgggtatgttccctgttgatcaattcactgctatcatcaatcctcctcaagcc
tgtatccttgctgtgggaaccactgttgatacagttgttcctgattcaacctctgaaaag
ggctttaaggttgcccccataatgaaatgcactcttagttccgatcatcgtgttgttgat
ggtgctatggctgctcgatttaccaccgccctaaaaaagatcttggaaaatccattggag
attatgctttaa

DBGET integrated database retrieval system