KEGG   Schizosaccharomyces pombe (fission yeast): SPCC794.10Help
Entry
SPCC794.10        CDS       T00076                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (predicted) (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPCC794.10
   00052 Galactose metabolism
    SPCC794.10
   00500 Starch and sucrose metabolism
    SPCC794.10
   00520 Amino sugar and nucleotide sugar metabolism
    SPCC794.10
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPCC794.10
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:270966..272465
Genome map
AA seq 499 aa AA seqDB search
MLHRRIHFKSQSTLDFDSVAVSISASTMKNELDKLVLNSRVSDKKTFGIQMDNFFALYRR
YLLHTVKGYECDWDSIRPLGPEDMIDYGDLPLCKNAGKYLNRLAVVKLNGGMGNALGVNY
PKAMIEVRDNQSFLDLSIRQIEYLNRRYDVSVPFILMNSYDTNDETCKVLRKYAGCKIDI
STFEQSRYPRVFVDSQLPVPKAAPSPIEEWYPPGHGDIFDALVHSGTIERLLAQGKDYLF
VSNIDNLGASVDLNILSHVIDNQIEYSMEITDKTKADIKVGILVNQDGLLRLLETNQVPE
QHREEFMSDKVFKYINTNNVWLYLPAVKRVVENRELNLDIMPNIETVYYNNEPARIIEFT
TAIGSAISQFKKTEGIRVSRPRFISVKNSSDLFLVRCDLYNVDHGSLKIEESRLGFPPPV
VRMSNEFKDIAELFCRIPYMPSMKDLVSLSISGNVYFGRNVILKGNIVIVASENTILCIP
SNAVLENCVVTGNCKIMEC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttgcatcgtcgaattcattttaaatcacagtccactttggactttgacagtgttgca
gttagcatatctgccagtacgatgaaaaacgaattagataaacttgtactgaattccaga
gtttcggataaaaaaacgtttggcatacaaatggacaacttctttgctttgtatagaaga
tatttattacacacagttaaaggttatgaatgtgattgggattctatccggcctctggga
cccgaagacatgatagattacggtgatttaccgttatgcaaaaatgctggaaagtactta
aatcggcttgcagttgttaaattaaatggaggtatgggaaatgcgttgggtgtgaattat
cctaaagccatgattgaggttcgtgacaatcaaagtttcctcgaccttagcattcgccaa
atcgaatatcttaacagacggtacgatgtgtccgtgcctttcattttaatgaactcttac
gatacaaatgatgaaacctgtaaagttcttcgaaaatatgcaggctgcaagattgatatt
tctactttcgaacaatctcgatatccccgtgtatttgttgactctcaacttcctgttcca
aaagctgctccctctcctattgaggagtggtacccaccaggtcatggtgatatttttgat
gcgttagtccactccggtacaattgagcgattgctcgctcagggtaaagattacttattt
gtcagcaacatcgacaatctcggggcttcggtggatcttaatattctgtctcatgtcata
gacaatcaaatcgagtactcgatggaaattactgataaaacaaaagctgatattaaagtt
ggcatccttgtcaaccaggacggcttactaagacttttagaaaccaaccaagttcccgaa
caacatcgagaagaatttatgtctgataaagttttcaaatacattaatacgaataatgtg
tggctttaccttccggcagtcaaacgcgtagttgaaaaccgagaactcaacttagatatt
atgccaaacatcgaaaccgtctactataacaatgagcctgcacgaattatagaatttacg
acagcaattggttccgctatcagccaatttaaaaaaaccgagggaattcgagtttcaaga
ccacgctttatttctgtcaagaattcctccgatttattcttggtacgatgtgatttatac
aacgttgatcatggttccttaaaaattgaagaatcaaggctcggttttccccctccagtc
gttcgcatgtctaatgaatttaaagatatcgcagaacttttttgccgtattccttacatg
cctagcatgaaagacctagtttctctatccatttctggaaatgtatatttcggaagaaac
gtgatattaaaaggaaacatcgtgattgttgcttcggaaaataccatcctttgcatccct
tccaatgcagttttagaaaattgtgttgtgacaggaaattgtaaaataatggagtgttga

DBGET integrated database retrieval system