KEGG   Schizosaccharomyces pombe (fission yeast): SPCC830.06Help
Entry
SPCC830.06        CDS       T00076                                 

Definition
calcineurin regulatory subunit (predicted)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Protein phosphatases and associated proteins [BR:spo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SPCC830.06
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:join(2192204..2192255,2192449..2192685,2192748..2192860,2192914..2193036)
Genome map
AA seq 174 aa AA seqDB search
MGQSQSQIFEDLISNSSFSNEEIERIRKRFIKIDANQSGSIDRNEFLSIPSVASNPLASR
LFSVVDEDGGGDVDFQEFINSLSVFSVHGNKEEKLKFAFKIYDIDRDGYISNGELYLVLK
MMVGTNLREDQLQQIVDKTIMEVDKDRDGKISFEEFKDIVSGSNVTSSMTLDSF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagtcgcagtcgcaaatctttgaggacttgatctcaaattcatccttttccaat
gaggagatagaaagaattcgcaagcgttttattaaaatagatgctaaccaatctggctct
attgaccgaaacgaatttttgtcgattcccagtgtagcttctaacccacttgcttccaga
ctgttttcagttgtagacgaagacggtggaggagatgtggactttcaagaatttattaat
agcctttctgtattttcagtgcatggcaataaagaggaaaagctgaagtttgccttcaag
atttatgatattgaccgtgatggttatatttcaaacggagaactttatctagttctgaaa
atgatggttggcacgaatcttcgggaagatcaattgcagcagattgttgacaaaaccatt
atggaagttgataaggatcgcgatggaaaaattagctttgaagagttcaaagatattgtc
agcggttccaacgttactagtagcatgacactcgattctttttga

DBGET integrated database retrieval system