KEGG   Schizosaccharomyces pombe (fission yeast): SPCC970.03Help
Entry
SPCC970.03        CDS       T00076                                 

Definition
cytochrome b5 reductase (predicted) (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPCC970.03
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SPCC970.03
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(510435..511340)
Genome map
AA seq 301 aa AA seqDB search
MAKQTLLSTPLHGVYIPVFLIIFGTYIVKREWVGYAIVVAFSLGFHKFWRGRVRKVLSDK
IQQFELSDKAVLNHNTAIYRFRLPRANDVLGLPIGQHLKVFVDVDGKEYSRSYTPLSSDA
DKGYFDLLVKSYPNGKVSKKFSELKIGDTIGVRGPKGNWKHRTGLARHFGMIAGGTGITP
MLQIIRAVLSNFEDPTEITLLYANVSEGDIVLRDEIDALAKKDPRFTVHYVLNNPPENWK
GSVGFVTQELIKAHFPAPSPETKVLICGPTPMVNSLREATVALGYEKSRAISKLEDQVFV
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacaaactcttcttagtaccccgttgcatggagtctatattccagtgtttttg
atcatctttggtacttacattgtgaaacgcgaatgggtgggttacgctattgttgtggca
ttctctcttggttttcataagttctggcgtggacgcgttcgtaaagtattgagtgataaa
attcaacaatttgaacttagtgataaagctgtattgaaccacaacactgccatttatcgt
ttccgtctgcctcgcgctaacgatgttcttggtctccccataggacaacatttaaaggtc
tttgttgatgttgatggtaaggagtattccagatcttacactcctctgtcttccgatgct
gacaaaggttattttgatttgctcgtaaagtcttaccccaatggcaaagtgagtaagaag
ttttctgaacttaagattggtgataccatcggtgttcgtggccctaagggaaattggaag
catcgcactggcctcgcgcgccattttggcatgatcgcaggcggaacaggtattactcct
atgcttcaaatcattcgtgctgttctttctaattttgaagatccaacggaaatcactctt
ttatatgctaatgtatcagagggtgatattgttcttcgtgatgagattgacgcacttgct
aagaaggatcctcgttttaccgttcattatgttttgaacaatcctcctgaaaactggaag
ggaagtgttggatttgttactcaagaacttatcaaggcgcatttccctgctccttctcct
gaaaccaaagttcttatttgtggccctactcccatggttaattcactcagagaagctaca
gttgcattgggatatgaaaagtcccgagccatttcgaagcttgaggatcaagtatttgtc
ttttag

DBGET integrated database retrieval system