KEGG   Streptococcus pneumoniae P1031: SPP_0122Help
Entry
SPP_0122          CDS       T00874                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spp00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:spp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(94962..98897)
Genome map
AA seq 1311 aa AA seqDB search
MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTTTTENQPTIHTVSDSPQSSENR
TEETPKAELQPEAPKTVETETPATDKVASLPKTEEKPQEEVSSTPSDKAEVVTQTSAEKE
TANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKAEADKPETEAGKERAATVN
EKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANG
KTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAI
LNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDE
YANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYY
NSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGW
YNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANAN
AEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIA
KLQETVNNLTLTPEALKEEEAKREVEKLAKNKVISIDAGRKYFTLNQLKRIVDKASELGY
SDVHLLLGNDGLRFLLDDMTITANGKTYASDDVKKAIIEGTKAYYDDPNGTALTQAEVTE
LIEYAKSKDIGLIPAINSPGHMDAMLVAMEKLGIKNPQAHFDKVSKTTMDLKNEEAMNFV
KALIGKYMDFFAGKTKIFNFGTDEYANDATSAQGWYYLKWYQLYGKFAEYANTLAAMAKE
RGLQPMAFNDGFYYEDKDDVQFDKDVLISYWSKGWWGYNLASPQYLASKGYKFLNTNGDW
YYILGQKPEDGGGFLKKAIENTGKTPFNQLASTKYPEVDLPTVGSMLSIWADRPSAEYKE
EEIFELMTAFADHNKDYFRANYNALREELAKIPTNLEGYSKESLEALDAAKTALNYNLNR
NKQAELDTLVANLKAALQGLKPAATHSGSLDENEVAANVETRPELITRTEEIPFEVIKKE
NPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQVVEVGAPVTHK
GDESGLAPTTEVKPRLDIQKEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFYSVSTS
ADGKEVKTLVNSVVAQEAVTQIVEVGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTAP
AEESKALPQDPAPVVTEKKLPETGTHDSAGLVVAGLMSTLAAYGLTKRKED
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgaaaaacaacagcgtttttctattcgtaaatacgctgtaggagcagcttct
gttctaattggatttgccttccaagcacagactgttgcagccgatggagttactactact
acagaaaaccaaccgaccatccatacagtttctgattcccctcaatcatccgaaaatcgg
actgaggaaacacctaaagcagagcttcaaccagaagctccaaaaactgtagaaacagaa
actccagctactgataaggtagctagtcttccaaaaacagaagaaaaaccacaagaggaa
gttagttcaactcctagtgataaagcagaggtggtaactcaaacttctgctgaaaaagaa
actgctaataaaaaggcagaagaagctagccctaaaaaggaagaagcgaaagaggttgat
tctaaagagtcaaatacagacaagactgacaaggataaaccagctaaaaaagatgaagcg
aaagcagaggctgacaaaccggaaacagaggcaggaaaggaacgtgctgcaactgtaaat
gaaaaactagcgaaaaagaaaattgtttctattgatgctggacgtaaatatttctcacca
gaacaactcaaggaaatcatcgataaagcgaaacattatggctacactgatttacaccta
ttagtcggaaatgatggactccgtttcatgttggacgatatgagcatcacagctaacggc
aagacctatgccagtgacgatgtcaaacgcgccattgaaaaaggtacaaatgattattac
aacgatccaaacggcaatcacttaacagaaagtcaaatgacagatctgattaactatgcc
aaagataaaggtatcggtctcattccgacagtaaatagtcctggacacatggatgcgatt
ctcaatgccatgaaagaattgggaatccaaaaccctaactttagctattttgggaagaaa
tcagcccgtactgtcgatcttgacaacgaacaagctgtcgcttttacaaaagcccttatc
gacaagtatgctgcttatttcgcgaaaaagactgaaatcttcaacatcggacttgatgaa
tatgccaatgatgcgacagatgctaaaggttggagtgtgcttcaagctgataaatactat
ccaaacgaaggctaccctgtaaaaggctatgaaaaatttattgcctacgccaatgacctc
gctcgtattgtaaaatcgcacggtctcaaaccaatggcttttaacgacggtatctactac
aatagcgacacaagctttggtagttttgacaaagacatcatcgtttctatgtggactggt
ggttggggaggctacgatgtcgcttcttctaaactactagctgaaaaaggtcaccaaatc
cttaataccaatgatgcttggtactacgttcttggacgaaacgctgatggccaaggctgg
tacaatctcgatcaggggctcaatggtattaaaaacacaccaatcacttctgtaccaaaa
acagaaggagctgatatcccaatcatcggtggtatggtagctgcttgggctgacactcca
tctgcacgttattcaccatcacgcctcttcaaactcatgcgtcattttgcaaatgccaac
gctgaatacttcgcagctgattatgaatctgcagagcaagcacttaacgaggtaccaaaa
gacctgaaccgttatactgcagaaagcgtcacggccgtaaaagaagctgaaaaagctatt
cgctctctcgatagcaaccttagccgtgcccaacaagatacgattgatcaagccattgct
aaacttcaagaaactgtcaacaacttgaccctcacgcctgaagctctaaaagaagaagaa
gctaaacgtgaggttgaaaaacttgccaaaaacaaggtaatctcaatcgatgctggacgc
aaatactttactctgaaccagctcaaacgcatcgtagacaaggccagtgagctcggatat
tctgatgtccatctccttctaggaaatgacggacttcgctttctactcgatgatatgacc
attactgccaacggaaaaacctatgctagtgatgacgttaaaaaagctattatcgaagga
actaaagcttactacgacgatccaaacggtactgcactaacacaggcagaagtaacagag
ctaattgaatacgctaaatctaaggacatcggtctcatcccagctattaacagtccaggt
cacatggatgctatgctggttgccatggaaaaattaggtattaaaaatcctcaagcccac
tttgataaagtttcaaaaacaactatggacttgaaaaacgaagaagcgatgaactttgta
aaagcccttatcggtaaatacatggacttctttgcaggtaaaacaaagattttcaacttt
ggtactgacgaatacgccaacgatgcgactagtgcccaaggctggtactacctcaagtgg
tatcaactctatggcaaatttgccgaatatgccaacaccctcgcagctatggccaaagaa
agagggcttcaaccaatggccttcaacgatggcttctactatgaagacaaggacgatgtt
cagtttgacaaagatgtcttgatttcttactggtctaaaggctggtggggatataacctc
gcatcacctcaatacctagcaagcaaaggctataaattcttgaataccaacggtgactgg
tactacattcttggtcaaaaaccagaagatggtggtggtttcctcaagaaagctattgag
aatactggaaaaacaccattcaatcaactagcttctaccaaatatcctgaagtagatctt
ccaacagtcggaagtatgctttcaatctgggcagatagaccaagcgctgagtacaaggaa
gaggaaatctttgaactcatgactgcctttgcagaccacaacaaagactacttccgtgct
aattataatgctctccgcgaagaattagctaaaattcctacaaacttagaaggatatagt
aaagaaagtcttgaggcccttgacgcagctaaaacagctctaaattacaacctcaaccgt
aataaacaagctgagcttgacacacttgtagccaacctaaaagccgctcttcaaggcctc
aaaccagctgcaactcattcaggaagcctagatgaaaatgaagtggctgccaatgttgaa
accagaccagaactcatcacaagaactgaagaaattccatttgaagttatcaagaaagaa
aatcctaacctcccagctggtcaggaaaatattatcacagcaggagtcaaaggtgaacga
actcattacatctctgtactcactgaaaatggaaaaacaacagaaacagtccttgatagc
caggtaaccaaagaagttataaaccaagtggttgaagttggcgctcctgtaactcacaag
ggtgatgaaagtggtcttgcaccaactactgaggtaaaacctagactggatatccaaaaa
gaagaaattccatttaccacagtgactcgtgaaaatccactcttactcaaaggaaaaaca
caagtcattactaagggcgtcaatggacatcgtagcaacttctactctgtgagcacttct
gccgatggtaaggaagtgaaaacacttgtaaatagtgtcgtagcacaggaagccgttact
caaatagtcgaagtcggaactatggtaacacatgtaggcgatgaaaacggacaagccgct
attgctgaagaaaaaccaaaactagaaatcccaagccaaccagctccatcaactgctcct
gctgaggaaagcaaagctcttcctcaagatccagctcctgtggtaacagagaaaaaactt
cctgaaacaggaactcacgattctgcaggactagtagtcgcaggactcatgtccacacta
gcagcctatggactcactaaaagaaaagaagactaa

DBGET integrated database retrieval system