KEGG   Streptococcus pneumoniae P1031: SPP_0341Help
Entry
SPP_0341          CDS       T00874                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPP_0341 (folE)
Enzymes [BR:spp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SPP_0341 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296905..297459
Genome map
AA seq 184 aa AA seqDB search
MDTQKIEAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID
DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLN
IEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYR
LMGL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacacaaaagattgaagcagctgtaaaaatgattatcgaggctgtaggagagaac
gctaatcgcgagggcttgcaggaaacacctgctcgtgtagcccgtatgtatcaagagatt
ttttcaggtcttggtcaaacagcagaggaacatttgtcaaaatcctttgaaattattgac
gataatatggtggtagaaaaggatatctttttccataccatgtgtgaacaccacttcttg
ccattttatggtagagcgcacattgcctacattccagatggtcgtgtggcaggcttgtct
aagctagcccgtacggttgaagtttattcgaaaaaaccacaaattcaagaacgtttgaat
atcgaagtggccgatgccttgatggactatctaggtgctaaaggagcctttgttgtcatt
gaggcggaacatatgtgtatgagtatgcgtggtgttagaaaaccaggcactgcaaccttg
acgacagtagctcgtggtttatttgaaacagataaggacctccgcgaccaagcttatcgt
ttaatggggctataa

DBGET integrated database retrieval system