KEGG   Streptococcus pneumoniae P1031: SPP_0456Help
Entry
SPP_0456          CDS       T00874                                 

Gene name
accC
Definition
acetyl-CoA carboxylase biotin carboxylase subunit (EC:6.4.1.2)
Orthology
K01961  
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Carbon metabolism [PATH:spp01200]
Metabolism; Overview; Fatty acid metabolism [PATH:spp01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:spp00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:spp00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:spp00061]
Metabolism; Metabolism of terpenoids and polyketides; Tetracycline biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
407736..409103
Genome map
AA seq 455 aa AA seqDB search
MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLADEAVCIGPGKATESY
LNINAVLSAAVLTEAEAIHPGFGFLSENSKFATMCEEVGIKFIGPSGHVMDMMGDKINAR
AQMIKAGVPVIPGSDGEVHNSEEALIVAEKIGYPVMLKASAGGGGKGIRKVEKPDDLVSA
FETASSEAKANYGNGAMYIERVIYPARHIEVQILGDEHGHVIHLGERDCSLQRNNQKVLE
ESPSIAIGKTLRHEIGAAAVRAAEFVGYENAGTIEFLLDEASSNFYFMEMNTRVQVEHPV
TEFVSGVDIVKEQICIAAGQPLSVKQEDIVLRGHAIECRINAENPAFNFAPSPGKITNLY
LPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRFDALMKMQRALYELEIEGVQTN
ADFQLDLISDRNVIAGDYDTSFLMETFLPKYQEKE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaaaaattttaattgccaatcgtggtgaaattgcggttcgtattatccgtgcg
gcacgtgaattggggattgcgacggtagcggtttattcaactgctgataaggaagctctt
catacgcttttggcagatgaagcagtttgtattggtcctggcaaggcaacagagtcttat
ctcaatattaatgcagttctatcagctgcagtcttgactgaggcagaagctattcaccct
ggttttggatttctcagtgaaaattccaaatttgcgaccatgtgtgaagaagtaggtatc
aagtttatcggtccatctggtcatgttatggatatgatgggggataagatcaatgcgcgt
gctcagatgattaaagcaggtgtgcctgttataccaggttcagatggagaagtgcataac
tctgaagaagctttgattgttgctgaaaaaattggctatcctgttatgctcaaggcttca
gcaggtggaggtggtaaagggattcgtaaggttgaaaaaccagatgacctcgtttctgcc
tttgaaactgcctctagtgaggccaaggccaattatggcaatggtgccatgtacatagaa
cgggttatctatccagctcggcacattgaggttcaaatcctaggtgatgagcatggacat
gtgattcacttgggtgaacgggattgttctcttcaaaggaataaccaaaaggttttggaa
gaaagtccctcgattgcaatcggaaaaacgctgcgtcatgaaataggtgctgctgctgtt
cgagcggcagagtttgttggctatgagaatgcaggaaccattgaatttcttcttgatgaa
gcaagtagcaatttctatttcatggagatgaatactcgtgttcaggtagaacatccagta
acagagtttgtttcaggtgttgatatcgttaaggaacagatttgcattgcggcaggtcag
cctttgtctgttaagcaagaagatattgtcctacgtggtcatgccatcgagtgtcgtatc
aatgcagaaaacccagcctttaactttgctccaagtccaggtaagattactaatctctat
ctgccaagtggtggagttggtttgcgcgtggattcagcagtttatccaggttataccatt
ccgccttattatgatagtatgattgccaaaatcatagtacacggcgaaaatcgttttgac
gccttgatgaaaatgcaacgtgccctctatgaattagagattgaaggagtgcagaccaat
gcagatttccagcttgacctcatttcagatcgcaatgtcattgctggggattatgatact
tccttcttgatggaaaccttcttacctaaatatcaagaaaaagaataa

DBGET integrated database retrieval system