KEGG   Streptococcus pneumoniae P1031: SPP_0594Help
Entry
SPP_0594          CDS       T00874                                 

Definition
beta-glucosidase (Gentiobiase) (Cellobiase) (Beta-D-glucoside glucohydrolase) (Amygdalase) (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPP_0594
Enzymes [BR:spp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPP_0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534139..535554
Genome map
AA seq 471 aa AA seqDB search
MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEATENPTEDNLKLIGIDF
YHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKYYDELFDELHAHGIEPL
VTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKVKYWLTFNEVNSVLELPF
TSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEFKVGCMVLAMPAYPMTPNP
KDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKENDINIEFAAEDAELLKNYTVDFLSF
SYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQIDPIGLRIILNRYYDRYQIPL
FIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMKEHLLQVAEALQDGVEIMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWYKGVIESNGESLFK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttttccagatgattttctttggggtggagctgttgcagctaatcaagtagag
ggagcatataatgaagatggtaagggcttatcagttcaggatgtgttacccaaaggtgga
ttaggagaagcaacagaaaatcctacagaagataacttaaaattgataggtattgatttt
tatcataaatataaggaagatatatccttgttttctgaaatgggctttaatgtttttcgt
acttctattgcatggagtagaatttttccaaaaggagatgaggaagaacctaacgaagct
gggttgaaatattatgatgaattgtttgatgaactacatgctcacgggatagaaccactt
gtaactctttcacactatgagactccattatatttagcaagaaaatatcatggatggatt
gataggagaatgattcatttttatgaaaaatttgctcgaacagttttagaaaggtataaa
gataaagttaaatattggcttacatttaacgaagtaaactctgttttggaattaccgttt
actagtggaggaatagatatacctaaggagaatctttcgaaacaagaattatatcaagct
atacatcatgaattagtcgcctcgagtttggttacaaaaattgctcgtgagattaattca
gagtttaaggtggggtgtatggtattagctatgccagcttatccaatgactccaaatcca
aaagatgtatgggcgactcatgagtatgagaatctaaattatctattttcagatgtgcat
gttagaggttattatccgaattatgcaaaaagatattttaaggaaaatgacattaacata
gagtttgcagctgaagatgcagagttattaaaaaattatactgtagattttttatccttt
agctattacatgagtgtgactcaatctgctcttccaacacagtataattcaggagaaggg
aatattattggtggtttagtaaatccttatttagagtcttctgagtggggatggcaaatt
gatccaattggactacgtataattttaaatagatattatgaccgttatcaaattccatta
tttatagtggaaaacggattaggtgctaaagatcaactaataaaagatgaatttaataac
ttaacagtccaagatgattatagaattcagtatatgaaagaacatttattgcaagtagct
gaagctctacaagatggtgtggaaattatgggctatacgtcttggggatgtattgactgc
gtttctatgtccactgcacagctttctaagaggtacggtctcatttatgttgatcgaaat
gatgatggaaatggcacattcaatcgatataagaaaatgtcctttacttggtataaagga
gtgattgaatcaaatggagaatccttattcaaatag

DBGET integrated database retrieval system