KEGG   Streptococcus pneumoniae P1031: SPP_0746Help
Entry
SPP_0746          CDS       T00874                                 

Definition
6-phospho-beta-glucosidase AscB, truncation
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPP_0746
Enzymes [BR:spp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPP_0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680910..681191
Genome map
AA seq 93 aa AA seqDB search
MDTPDENGYVADDYRITYLEAHIKAMRDAIYQDGIDLLGYTTWSCIDPVSAGTGEMNKRY
GFIYVDRDNVGNGTLKRSKKKSFYWYMSFIAMV
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggatacaccggatgagaatggttatgtagcagatgactatcggattacttacttagag
gcccacatcaaggccatgcgagatgccatttaccaagatgggattgacttgcttggttat
acgacttggagctgtatcgatccggtttcagctggcacaggggaaatgaataagcgctat
ggctttatctatgtagatcgagataatgtaggaaatgggactctcaaacgtagcaagaag
aagtccttctattggtacatgtcatttatagcaatggtgtaa

DBGET integrated database retrieval system