KEGG   Streptococcus pneumoniae P1031: SPP_1122Help
Entry
SPP_1122          CDS       T00874                                 

Gene name
ligA
Definition
NAD-dependent DNA ligase LigA (EC:6.5.1.2)
Orthology
K01972  
DNA ligase (NAD+) [EC:6.5.1.2]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:spp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SPP_1122 (ligA)
   03410 Base excision repair
    SPP_1122 (ligA)
   03420 Nucleotide excision repair
    SPP_1122 (ligA)
   03430 Mismatch repair
    SPP_1122 (ligA)
Enzymes [BR:spp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     SPP_1122 (ligA)
DNA replication proteins [BR:spp03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    Other elongation factors
     SPP_1122 (ligA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1025739..1027697
Genome map
AA seq 652 aa AA seqDB search
MNKRMNELVALLNRYATEYYTSDNPSVSDSEYDRLYRELVELETAYPEQVLADSPTHRVG
GKVLDGFEKYSHQYPLYSLQDAFSREELDAFDARVRKEVAHPTYICELKIDGLSISLTYE
KGILVAGVTRGDGSIGENITENLKRVKDIPLTLPEELDITVRGECYMPRASFDQVNQARQ
ENGEPEFANPRNAAAGTLRQLDTAVVAKRNLATFLYQEASPSTRDSQEKGLKYLEQLGFV
VNPKRILAENIDEIWNFIQEVGQERENLPYDIDGVVIKVNDLASQEELGFTVKAPKWAVA
YKFPAEEKEAQLLSVDWTVGRTGVVTPTANLTPVQLAGTTVSRATLHNVDYIAEKDIRKD
DTVIVYKAGDIIPAVLRVVESKRVSEEKLDIPTNCPSCNSDLLHFEDEVALRCINPRCPA
QIMEGLIHFASRDAMNITGLGPSIVEKLFAANLVKDVADIYRLQEEDFLLLEGVKEKSAA
KLYQAIQASKENSAEKLLFGLGIRHVGSKASQLLLQYFHSIENLYQADSEEVASIESLGG
VIAKSLQTYFATEGSEILLRELKETGVNLDYKGQTVVADAALSGLTVVLTGKLERLKRSE
AKSKLESLGAKVTGSVSKKTDLVVVGADAGSKLQKAQELGIQVRDEAWLESL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagaatgaatgagttagtcgctttgctcaatcgctatgcgactgagtactat
accagcgataatccctcggtttcagacagtgagtatgaccgcctttaccgtgagttggtc
gagttagaaactgcttatccagagcaagtgctagcagacagtccgactcatcgtgttggt
ggcaaggttttagatggttttgaaaaatacagtcatcagtatcctctttatagtttgcag
gatgctttttcacgtgaggagctagatgcttttgatgcgcgtgttcgtaaggaagtggct
catccgacctatatttgtgagctgaaaatcgatggcttatctatctcgctgacttatgaa
aaggggattttggttgctggggtaacacgtggagatggttcaattggtgaaaatatcaca
gaaaacctcaagcgtgttaaggacatccctttgactttgccagaagaactagatatcaca
gttcgtggggaatgttacatgccacgcgcttcctttgaccaagttaaccaagcgcgccaa
gaaaatggagagcctgaatttgctaatcctcgtaatgcggcagcaggaactctgcgtcag
ttggatacagcagtagttgcaaagcgtaatcttgcaacgtttctctatcaagaagccagt
ccttcaactcgtgatagccaagaaaagggtttgaagtacctagaacaactaggttttgtg
gtcaatcctaagcgaatcttggctgaaaacatagatgaaatctggaattttatccaagaa
gtaggacaggaacgggaaaatctaccttacgatattgatggagtggtaatcaaggtcaac
gacctagcaagtcaagaagaacttggttttaccgttaaggctccaaagtgggcagtagcc
tacaagttccctgctgaagaaaaagaagctcaactcttatcagttgactggacagttggc
cgtaccggtgttgtaactccaactgctaatctaacaccagtacaacttgccggtacgact
gttagccgtgcgaccctgcacaatgtagattatattgctgaaaaagatatccgaaaagac
gatacggtcattgtatataaggctggtgacatcatccctgccgttttacgtgtggtagag
tccaaacgggtttctgaagaaaaactagatatccctacaaactgtccaagttgtaactct
gacttgttgcactttgaagatgaagtggccctacgttgtatcaatccgcgttgccctgct
caaatcatggaaggcttgattcactttgcttctcgtgatgctatgaatattacaggcctt
ggtccatctattgttgagaagctttttgctgctaatttagtcaaggatgtggcggatatt
tatcgtttgcaagaagaggatttcctccttttagagggggttaaggaaaagtccgctgct
aaactgtatcaggctatccaagcatcaaaggaaaattctgccgagaagctcttatttggt
ttgggaattcgtcatgtcggaagcaaggctagtcagcttttacttcaatatttccattca
attgaaaatctgtatcaggcagattcagaggaagtggctagtattgaaagtctaggtggc
gtgattgccaaaagtcttcagacttattttgcgacagaaggctctgaaattctgctcaga
gaattgaaagaaactggggtcaatctggactataaaggacagacggtagtagcggatgcg
gccttgtcaggtttgaccgtggtattgacaggaaaattggaacgactcaagcgctcagaa
gctaaaagtaaactcgaaagtctgggtgccaaagtgacaggtagtgtttctaaaaagacc
gacctcgtcgtggtaggtgcagacgctggaagtaaactgcaaaaagcacaagaacttggt
atccaggtcagagatgaggcatggctagaaagtttgtaa

DBGET integrated database retrieval system