KEGG   Streptococcus pneumoniae P1031: SPP_1594Help
Entry
SPP_1594          CDS       T00874                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spp00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:spp00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1475492..1475998)
Genome map
AA seq 168 aa AA seqDB search
MTKKIVAIWAQDEEGVIGKENRLPWHLPAELQHFKETTLNHAILMGRVTFDGMGRRLLPK
RETLILTRNPEEKIDGVATFQDVQSVLDWYQAQEKNLYIIGGKQIFQAFEPYLDEVIVTH
IHARVEGDTYFPEELDLSLFETVSSKFYAKDEKNPYDFTIQYRKRKEL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaaaatcgtagctatttgggcccaggatgaagagggtgtgattggtaaggaa
aatcgtctgccttggcatttgccagcagaattgcagcactttaaagaaacaactctgaat
catgctatcttgatggggcgtgtgacctttgatgggatggggcgtcgcttgcttccaaaa
cgggaaaccttgattttgacgcgtaatccggaagaaaagatagatggggttgctactttt
caggacgtccagtctgttcttgactggtatcaggctcaagaaaagaatctctacattatt
ggtgggaagcaaatttttcaggcttttgaaccttaccttgatgaagtgattgtcactcac
attcatgctcgtgtggaaggagatacctatttccctgaagaacttgacttgtctcttttt
gagacagtttcaagcaaattttacgccaaagatgagaagaatccttatgattttaccatc
caataccgcaagagaaaggaactctaa

DBGET integrated database retrieval system