KEGG   Streptococcus pneumoniae P1031: SPP_1819Help
Entry
SPP_1819          CDS       T00874                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
spp00260  Glycine, serine and threonine metabolism
spp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spp01100  Metabolic pathways
spp01110  Biosynthesis of secondary metabolites
spp01130  Biosynthesis of antibiotics
spp01230  Biosynthesis of amino acids
Module
spp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPP_1819 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPP_1819 (trpA)
Enzymes [BR:spp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPP_1819 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: ACO21902
UniProt: C1CMD2
Structure
PDB: 

Jmol
Position
complement(1686644..1687420)
Genome map
AA seq 258 aa AA seqDB search
MPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLDGLAETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQALVETLKTIETEIPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPDLPHEHANFVEPFLADTDIALIPLVSLTTGIERQKELIEGAEGFVYAVAIN
GVTGKSGNYRADLDKHLAQLHQVADIPVLTGFGVSSQADLERFNAVSDGVIVGSKIVKAL
HQGEPIQDFIRQAVAYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacagaaaaattgaatgctattaaagcagctggaaaaggaattttt
gttccctatatcatggctggtgaccacgagaaaggtttggacggtcttgctgaaacaatt
cactttttagaagatttgggtgtctctgcaattgaagtgggtattcccttttcagaccct
gttgcagatggacctgttatcgaagaagctggcttgcgcagtttagcccacgggacctct
acccaggctttagttgaaaccttgaaaaccattgaaacagagattccactggtcatcatg
acctacttcaaccccctctttcagtacggtgtggagaactttgtcaaagatctggctgat
acagctgtgaagggcttgattatcccagacttgcctcatgaacatgccaactttgtagaa
ccatttttggcagatacagatatcgccttgattcctttagtaagcttgaccacaggaatt
gagcgccagaaagagttgattgaaggcgcggagggattcgtctatgccgttgccatcaat
ggggtgacagggaaatcaggcaattaccgtgcagatttggacaagcacttggcgcaactt
catcaagtggccgacatcccagtcttgacaggttttggtgtatctagtcaagccgatctg
gaacgcttcaatgcggtgtcagatggtgttatcgtcggttcgaaaatagtaaaagctctc
caccaaggagagccgattcaggattttatcagacaagcagtagcttaccaaaaataa

DBGET integrated database retrieval system