KEGG   Streptococcus pneumoniae P1031: SPP_2093Help
Entry
SPP_2093          CDS       T00874                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
spp00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPP_2093
Enzymes [BR:spp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SPP_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACO20388
Position
complement(1911812..1912870)
Genome map
AA seq 352 aa AA seqDB search
MKAYTYVKPGLASFVDVDKPVIRKPTDAIVRIVKTTICGTDLHIIKGDVPTCQSGTILGH
EGIGIVEEVGEGVSNFKKGDKVLISCVCACGKCYYCKKGIYAHCEDEGGWIFGHLIDGMQ
AEYLRVPHADNTLYHTPEDLSDEALVMLSDILPTGYEIGVLKGKVEPGCSVAIIGSGPVG
LAALLTAQFYSPAKLIMVDLDDNRLETALSFGATHKVNSSDPKKAIKEIYDLTDGRGVDV
AIEAVGIPETFDFCQKIIGVDGTVANCGVHGKPVEFDLDKLWIRNINVTTGLVSTNTTPQ
LLKALESHKIEPEKLVTHYFKLSEIEKAYEVFSKAADHHAIKVIIENDISEA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctatacttatgttaaaccaggacttgcttcttttgttgatgtagacaaacca
gttattcgcaagccaacagacgctattgtgcgtattgtaaaaaccactatttgtggaaca
gacctccatattatcaaaggggatgttcctacttgccaaagtggtaccattcttggccac
gaagggattgggattgttgaagaagttggggaaggagtttccaacttcaaaaaaggtgac
aaggtcttgatttcttgcgtctgtgcctgtggtaaatgctactactgtaaaaaaggaatt
tatgcccactgtgaagacgaagggggctggattttcggtcacttgattgatggtatgcag
gctgaatatctacgtgtccctcatgcagataatactctttaccatactccagaagacttg
tcagatgaagctttggttatgctgtcagacattctgcctactggatatgaaattggtgtc
ttaaaagggaaagtagaacctggttgcagcgtagccattattggttcaggtccagttgga
ttggctgctcttttaacagcccaattctattcaccagctaaattgattatggtagaccta
gacgataaccgcttggaaactgccctatcattcggtgcgactcataaggttaattcttca
gaccctaaaaaagccattaaagaaatttatgatttgacagatggtcgtggtgtggatgtc
gctatcgaagctgtagggattcctgaaacatttgatttctgtcaaaagattatcggtgta
gacggaacggttgccaactgtggtgtgcatggtaaaccagttgaattcgatttagataaa
ctttggattcgcaacatcaatgtaacaactggtttggtatctacaaatacgactccacaa
ttgttgaaagcacttgaaagtcataagattgaaccggaaaaattggtaactcactatttc
aaactcagtgaaattgaaaaagcctacgaagtcttcagtaaggcagcagaccaccatgcc
attaaggtcattatcgaaaacgatatctcagaagcctaa

DBGET integrated database retrieval system