KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_00004Help
Entry
SPAB_00004        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00260  Glycine, serine and threonine metabolism
spq00750  Vitamin B6 metabolism
spq01100  Metabolic pathways
spq01110  Biosynthesis of secondary metabolites
spq01120  Microbial metabolism in diverse environments
spq01230  Biosynthesis of amino acids
Module
spq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAB_00004
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPAB_00004
Enzymes [BR:spq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPAB_00004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABX65448
Position
3821..5107
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHELPEFSLTEIDEMLNQDFVSRSAKILS
AFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQICYYFEAVAQLPQGARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGKWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTMRELKAKGYISEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPADFAAL
RKLMMTRQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataatctgaaagaccataatgagcaggtcagctttgcgcaggccgtcacg
caaggactgggcaaacagcagggacttttttttccgcacgaactgccggagtttagcctg
acggaaattgatgagatgctcaaccaggactttgtcagccgtagcgcaaagatcctctcg
gcatttattggcgatgaaataccgcagcaaattctggaagagcgcgtccgcgcggcgttt
gcgttcccggcgccggtagcgcaggtagaaagcgatgtcggctgcctggagctgttccat
ggtccgacgctggcctttaaagacttcggcgggcgttttatggcgcaaatgctgacgcat
atcagcggcgacaaaccggtgacgattctgaccgcaacgtcaggcgataccggcgcggcg
gtggctcacgcgttctatggcctggaaaatgtgcgggtcgtcattctctacccgcgcggt
aagatcagtccgttgcaggaaaaactgttctgtacgctgggcggcaacattgaaaccgtg
gcgatcgacggcgatttcgacgcgtgccaggcgctggtgaaacaggcatttgatgacgaa
gaactgaaaacggcgctggggctgaattcggctaattcgattaatatcagccgcctgttg
gcgcaaatttgctactactttgaagccgtggcgcaactgccgcagggggcgcgtaaccaa
ctggtgatctccgtccccagcggcaactttggcgatttgacggcagggctgctggcgaag
tcgttaggcctaccggtgaaacgttttatcgccgccaccaacgtcaacgacacggtgccg
cgttttctgcatgacggaaagtgggcgccgaaagcgacgcaggcgaccctgtcgaatgcg
atggatgtcagccagccgaataactggccgcgcgtggaggagctattccgccgtaaaatc
tggcgcctgactgagctgggctatgcggcggtggatgacactacgacacaacagacgatg
cgcgagctgaaagcgaaaggttatatctcggaacctcatgcggcggtagcgtatcgggca
ttacgcgaccagttaaaccctggcgagtatggcttgtttctcggaacggcgcatccggcg
aagtttaaagaaagcgtggagtccattctgggagaaacgctggccttgcctgaagcgctc
gccgaacgcgccgatctgccgctgctttcacatcatctgcctgcggattttgccgccctg
cgtaagctgatgatgacccgccagtaa

DBGET integrated database retrieval system