KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_00234Help
Entry
SPAB_00234        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00790  Folate biosynthesis
spq01100  Metabolic pathways
Module
spq_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPAB_00234
Enzymes [BR:spq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SPAB_00234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ABX65676
Position
complement(214246..214725)
Genome map
AA seq 159 aa AA seqDB search
MTIAYIALGSNLASPLEQVNAALKAIANIPDSRIVAVSSFYRTPPLGPQDQPDYLNAAVA
LDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDEVINTDRLTVPHYDMK
NRGFMLWPLFEIAPKLRFPDDGVALTQLVHQHTPAPAYW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcgtatatcgcgcttggcagtaatctggcctctccgctggagcaggtcaat
gccgccctgaaggctatcgccaacattcccgatagccgtatcgttgcggtttcttcgttt
taccgcacgccgccgcttggcccacaggatcagcccgattacctgaacgccgcggtggcg
ctggataccgccctcgcccccgaagaattgcttaaccatacccagcgcattgagctgcaa
cagggccgggtgcgcaaagcggaacgctgggggccgcgcacgctggacctcgacattatg
ctgtttggcgatgaagtgattaacaccgaccgtctgacggttccgcactacgacatgaaa
aaccgcggctttatgctgtggccgctgtttgagatcgctccaaaactgcgcttccccgac
gatggcgtcgcgctgacgcagcttgttcatcaacatacccccgcaccagcatactggtaa

DBGET integrated database retrieval system