KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_00557Help
Entry
SPAB_00557        CDS       T00628                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPAB_00557 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAB_00557 (glk)
   00052 Galactose metabolism
    SPAB_00557 (glk)
   00500 Starch and sucrose metabolism
    SPAB_00557 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SPAB_00557 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPAB_00557 (glk)
   00524 Butirosin and neomycin biosynthesis
    SPAB_00557 (glk)
Enzymes [BR:spq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPAB_00557 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
526837..527802
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADSCIDCRRALSLFCVI
MGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYIHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattatcccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatagcgtcagcgtggaagatggttgt
atcgccatagcctgcccgattaccggtgactgggtagcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagccatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtatggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggaaaatctgcgcccgaaagatattaccgaa
cgcgccctggcggatagctgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatttggcggcgtttatatc
gctggcggtattgtcccgcgcttcctggaattttttaaagcgtccggcttccgtggtggc
tttgaagataaaggccgctttaaagattatatacacggtattccggtctatctgattgtc
catgataaccctggcttgttaggctccggcgcgcatctgcgccagacattaggtcatatt
ctataa

DBGET integrated database retrieval system