KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_00936Help
Entry
SPAB_00936        CDS       T00628                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SPAB_00936
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPAB_00936
Enzymes [BR:spq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SPAB_00936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
870133..870681
Genome map
AA seq 182 aa AA seqDB search
MIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKKNVLRG
LHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHG
FVTLSEYAEFLYKATNYYSPSSEGSILWNDETIGIEWPFSQLPELSAKDAAAPLLHQALL
TE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgattaaaacagcaataccagatgttttgatcttagagcctaaagtttttggc
gatgagaggggattcttttttgaaagttataaccagcagacctttgaagagttgattgga
cgtaaagttacatttgttcaagataatcattcaaaatccaaaaagaacgtactcagaggg
ctacattttcagagaggagaaaatgcacaggggaagttagttcgttgtgctgtcggtgag
gtttttgatgttgcggtcgatatccgaaaagaatcgcctacttttggtcaatgggttggc
gtaaatctatctgctgagaataagcgacagctttggattccagaaggttttgctcatggt
tttgttactcttagtgagtatgcagagtttctgtacaaagcaactaattattactcacct
tcatcggaaggtagcattttatggaatgatgagacaataggtattgaatggcctttttct
cagctgcctgagctttcagcaaaagatgctgcagcacctttactgcatcaagccttgtta
acagagtaa

DBGET integrated database retrieval system