KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_01203Help
Entry
SPAB_01203        CDS       T00628                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:spq00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1067253..1068239
Genome map
AA seq 328 aa AA seqDB search
MPLHHLTRFPRLELIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQC
EEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAG
QLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGIS
QKRFNDDGPSLFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactacatcacttaacgcgctttcctcgcctggagcttattggcgcgccgaccccg
ctcgaatacctgccgcgattgtctgattatcttggccgtgagatttacattaagcgcgat
gacgttacacccattgcaatgggcggcaataaactgcgtaagctggagtttctggtggcc
gacgcgctgcgagaaggggcggatacgctgataaccgcaggggcgattcagtcgaaccat
gtccgtcagacggcggcggtcgcggccaaattggggctgcattgcgtcgctttgctggaa
aatccaatcggtaccaccgcggaaaattacctgacgaatggtaatcgcctgttactggat
ttatttaatacgcaaattgagatgtgcgatgcgctaaccgatccggatgcgcagctgcaa
acgctggcgacgcgcattgaagcgcaagggttcaggccctatgtgattccggtcggcggc
tccagcgcgctgggggcaatgggatacgtagagagcgccctggaaatcgcccagcagtgt
gaagaggttgtcgggctctcttcggtggtggtggcctccggcagcgccggaacgcacgcc
gggttagctgtcgggctggaacatctgatgcctgacgtcgaactgattggcgtgaccgtt
tcacgttctgtcgccgagcagaaacccaaagtgattgccttgcagcaggctattgccggt
cagctggcgctgacggcgacggcggatattcatttatgggatgactattttgccccgggt
tacggcgtgccaaatgacgcggggatggaggcggtgaaactgctggcgagcctggagggg
gtgttgctggatccggtatataccggcaaagcgatggcgggtctgatagacggcatcagc
cagaaacgctttaacgatgacgggccgagtctctttattcacaccggtggggcgcctgcg
ctgtttgcctaccatcctcatgtataa

DBGET integrated database retrieval system