KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_01243Help
Entry
SPAB_01243        CDS       T00628                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:spq02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:spq02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1096433..1097482
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAARARIAAHKPMAAPATLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVIITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMYQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtattgtcagttgatgattccgcgctaatgcgccaaatcatgact
gaaattattaatagccatagcgatatggagatggtggcgactgcgccggacccgttggtc
gccagggatctcatcaaaaaatttaatccggacgtattgaccctggacgttgagatgccg
cgtatggacggcctcgattttctggaaaaactgatgcgcctgcgaccgatgccggtggtg
atggtctcttcgctgaccgggaaaggttctgaagtgacgctacgggcgctggagttgggg
gccatcgattttgtcaccaaaccgcagcttggcattcgtgaaggtatgctggcgtatagc
gagatgatcgccgaaaaagtgcgtaccgccgcgcgggcccgcatcgccgcacataaaccg
atggcggccccggcaaccttaaaagccggtccgttgctcagttcggaaaaactgattgct
atcggcgcttcaacgggcggtactgaagctatccgacatgtgctgcaaccgctgccgctt
tccagtccggcagtgattattacgcagcatatgccgcctggctttacccgctcgtttgcc
gagcgtctgaataaactctgtcaaatcagcgtgaaggaggccgaggacggcgaacgcgta
ttgccaggtcatgcctacattgcgcccggcgacaagcatatggagctggcgcgtagcggg
gcgaattatcaaatcaaaattcatgatggcccgccggtaaaccggcatcggccttccgtg
gatgtgctgtttcattcggtggcgaaacacgcgggacgcaacgccgtaggcgtcattctt
acggggatgggcaacgatggcgccgctggaatgttagcgatgtaccaggctggcgcctgg
accattgcgcaaaacgaagcaagttgtgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggcgtaagcgaagtggtcgatcttagccaggtaagccagcagatgctggcgaaa
atcagtgccggacaggcgatacgtatttga

DBGET integrated database retrieval system