KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_01492Help
Entry
SPAB_01492        CDS       T00628                                 

Definition
hypothetical protein
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:spq00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1275716..1276243
Genome map
AA seq 175 aa AA seqDB search
MRTVVYTAEIDDRFGAGKVSSRIGLSSPAKLFNQNTSLFEEIRAESARQTIHCVLVDESQ
FLTRQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLAWSDKLVELKTICFCGRK
ASMVLRLDQDGRPYNEGEQVVIGGNERYVSVCRKHYKDALEEGSLTAIQERHRHI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccgtcgtatatacggcggaaatcgacgatcgtttcggcgcaggcaaagtcagc
tctcgtatcggtttgtcgtcgccggcaaaattgtttaaccaaaatacatccttgtttgaa
gagattcgtgccgagagcgcgcggcagacaatacattgcgtgttagtcgacgaaagccag
tttttgactcgccagcaggtttatcaattatccgaggttgtcgacaaattagatattcca
gtactttgctatgggctacgaacagactttcgtggggagctctttgtcggcagccaatac
ttgctggcatggtcagataagctggtggaattaaaaactatctgtttctgcggtcgtaaa
gccagtatggttctgcgccttgatcaggacggcaggccttataacgaaggcgaacaggtg
gttattggcgggaatgaacgctacgtttcagtttgccgtaagcattataaggacgcgctg
gaggagggctcactgacggcgattcaggagcgtcatcggcacatatga

DBGET integrated database retrieval system