KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_01492Help
Entry
SPAB_01492        CDS       T00628                                 

Definition
hypothetical protein
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPAB_01492
Enzymes [BR:spq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPAB_01492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1275716..1276243
Genome map
AA seq 175 aa AA seqDB search
MRTVVYTAEIDDRFGAGKVSSRIGLSSPAKLFNQNTSLFEEIRAESARQTIHCVLVDESQ
FLTRQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLAWSDKLVELKTICFCGRK
ASMVLRLDQDGRPYNEGEQVVIGGNERYVSVCRKHYKDALEEGSLTAIQERHRHI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccgtcgtatatacggcggaaatcgacgatcgtttcggcgcaggcaaagtcagc
tctcgtatcggtttgtcgtcgccggcaaaattgtttaaccaaaatacatccttgtttgaa
gagattcgtgccgagagcgcgcggcagacaatacattgcgtgttagtcgacgaaagccag
tttttgactcgccagcaggtttatcaattatccgaggttgtcgacaaattagatattcca
gtactttgctatgggctacgaacagactttcgtggggagctctttgtcggcagccaatac
ttgctggcatggtcagataagctggtggaattaaaaactatctgtttctgcggtcgtaaa
gccagtatggttctgcgccttgatcaggacggcaggccttataacgaaggcgaacaggtg
gttattggcgggaatgaacgctacgtttcagtttgccgtaagcattataaggacgcgctg
gaggagggctcactgacggcgattcaggagcgtcatcggcacatatga

DBGET integrated database retrieval system