KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_01956Help
Entry
SPAB_01956        CDS       T00628                                 

Definition
bifunctional cysteine desulfurase/selenocysteine lyase
Orthology
K11717  
cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Selenocompound metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SPAB_01956
Enzymes [BR:spq01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SPAB_01956
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     SPAB_01956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1664830..1666050)
Genome map
AA seq 406 aa AA seqDB search
MTFPVEKVRADFPILQREVNGLPLAYLDSAASAQKPNQVIDAESAFYRHGYAAVHRGIHT
LSAQATESMENVRKQASRFINARSAEELVFVRGTTEGINLVANSWGTENIRAGDNIIISE
MEHHANIVPWQMLCERKGAELRVIPLHPDGTLRLETLAALFDDRTRLLAITHVSNVLGTE
NPLPDMIALARQHGAKVLVDGAQAVMHHAVDVQALDCDFYVFSGHKLYGPTGIGILYIKE
ALLQEMPPWEGGGSMISTVSLTQGTTWAKAPWRFEAGTPNTGGIIGLGAAIDYVTSLGLD
KIGDYEQMLMRYALEQLAQVPDITLYGPAQRLGVIAFNLGKHHAYDVGSFLDNYGIAVRT
GHHCAMPLMAWYGVPAMCRASLAMYNTHEEVDRLVAGLTRIHRLLG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacatttcctgtagaaaaagtacgggcggattttcccatactgcagcgtgaagttaac
ggcctgccgctggcttacctggacagcgcagccagcgctcaaaaacctaatcaggtgatt
gatgctgaatctgccttctaccgtcacggctatgctgcggtacatcggggtatccatacg
ttaagcgcgcaggcgaccgaaagcatggagaatgtgcgtaagcaggcgtcgcggtttatt
aacgcccgctccgcagaagaactggtgttcgtgcgcggtacgacggagggcattaacctt
gtcgccaacagttggggaacggaaaatattcgcgccggggataacattatcatcagcgag
atggagcatcacgccaacatcgttccctggcagatgctgtgcgagcgcaaaggcgctgaa
ctgcgcgtgatcccgttgcatcctgacggtacgctgcggctggagaccttagctgcgctg
ttcgatgaccggacccgactgctggccattacccacgtttccaatgtgctggggacggaa
aacccactgccggacatgattgcgctggcgcgccagcatggggcgaaagtgctggtggat
ggcgcccaggccgtgatgcaccatgctgttgacgtccaggcgctggactgcgatttttac
gttttctccggccataaactttacgggccgaccggcatcggcattctgtatattaaagag
gcgttgctgcaagaaatgccgccgtgggaagggggcgggtcgatgatctcgaccgtcagc
ctgacgcagggaacgacatgggcgaaagcgccctggcgttttgaggcgggaacgccgaat
actggcggcatcatcggtctcggcgcggcgattgactatgtgacgtcgctgggactggat
aagattggcgattatgagcagatgctgatgcgctatgcgctggagcaactggcgcaggtg
cctgatatcacgctgtatggtccggcacagcggttgggcgtcatcgcgtttaatctgggt
aaacaccatgcttacgacgtcggcagctttcttgataattacggtatcgcggtacgaacg
ggacatcactgcgcaatgccgctcatggcctggtatggcgtgccggcaatgtgccgggct
tcgctggcgatgtataacacccatgaagaagtggaccgactggtggcaggattaacgcgt
atccaccgcttattgggataa

DBGET integrated database retrieval system