KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_02801Help
Entry
SPAB_02801        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00020  Citrate cycle (TCA cycle)
spq00190  Oxidative phosphorylation
spq00650  Butanoate metabolism
spq01100  Metabolic pathways
spq01110  Biosynthesis of secondary metabolites
spq01120  Microbial metabolism in diverse environments
spq01130  Biosynthesis of antibiotics
spq01200  Carbon metabolism
Module
spq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPAB_02801
   00650 Butanoate metabolism
    SPAB_02801
  Energy metabolism
   00190 Oxidative phosphorylation
    SPAB_02801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABX68173
Position
complement(2325365..2325712)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAVRLILQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcatcctggtccgt
gctaccgctatcgttctgacgttatacatcatctacatggtgggttttttcgccacgagc
ggcgaactgacctttgaagcttggaccggtttcttctcatcggccttcaccaaagtcttc
accctgctggcgcttttttccatcttgattcatgcctggatcggcatgtggcaggtgtta
accgactacgttaaaccactggcagtgcgtctgatactgcaactcgttattgttgttgcg
ctggtggtttacgtcatctatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system