KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_03117Help
Entry
SPAB_03117        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K01738  cysteine synthase A [EC:2.5.1.47]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00270  Cysteine and methionine metabolism
spq00920  Sulfur metabolism
spq01100  Metabolic pathways
spq01110  Biosynthesis of secondary metabolites
spq01120  Microbial metabolism in diverse environments
spq01130  Biosynthesis of antibiotics
spq01200  Carbon metabolism
spq01230  Biosynthesis of amino acids
Module
spq_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SPAB_03117
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPAB_03117
Enzymes [BR:spq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     SPAB_03117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX68478
Position
2602253..2603308
Genome map
AA seq 351 aa AA seqDB search
MMSSNWVKNAINEINADHQRSADTHLIRLPLSAFPGIQLYLKDESTHPTGSLKHRLARSL
FLYGLCNGWIKEGTPIIEASSGSTAISEAWFARLLGLPFIAVMPACTAKRKIEQIQFYGG
HCHFVESACEIYAASERLAHELNGHYMDQFTYAERATDWRGNNNIADSIFRQMRNEPHPV
PRFIVMSAGTGGTSATIGRYIRCQGYDTQLMVVDPENSVFLPYWQDRDASLRSPVGSKIE
GIGRPRVEPSFIPDVVDEMLRVPDAASVATAHWLETQLGRKVGASTGTNMWGALQLAARM
REAGETGAIVTLLCDSGDRYLDTYYHPAWVSDHIGDLTPWSAAIAKLLTGD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtagcaattgggttaaaaatgccattaatgaaattaacgctgaccaccagcgt
tcagcggatacgcatcttattcgtttgcccctgtcggcatttccaggtatccagctttac
ctgaaagacgaaagcacgcatcccaccggtagcctcaagcatcgtctggcgcgctcgctg
ttcctttatgggttgtgcaatggctggattaaagaaggcactccgattattgaagcgtca
tcaggctcaacggcgatttccgaagcctggttcgcgcgtttactgggactgccgttcatc
gccgtcatgcccgcctgtaccgcaaaacgtaaaatcgaacagattcaattttacggcggc
cactgtcattttgtggagagcgcctgcgaaatttatgccgcctccgagcggctggcgcat
gaactgaacggtcactatatggaccagtttacctacgcagaacgagctaccgactggcgg
ggcaacaataatattgccgacagtattttccgccagatgcgcaacgaaccccatccggta
ccgcgatttatcgtcatgagcgccggaacgggcggaacctctgcgacgattgggcgctat
attcgctgccagggctatgatactcagctcatggtggtggatccggaaaattccgtcttt
ttaccttactggcaggatcgcgacgcttcattacgcagcccggtgggcagtaaaattgaa
ggaattggtcgtccgcgagtagagccttcttttattccggatgtcgtagatgagatgctg
cgcgtgccggacgccgccagcgttgccaccgcacactggctggaaacgcagctaggccgt
aaagtcggcgcctctaccggcacgaatatgtggggagctctgcagcttgcggcccggatg
cgcgaggctggagaaaccggcgctatcgtgacgttattgtgcgatagcggcgatcgctat
ctggatacctattaccatccggcctgggttagcgaccatatcggcgatttgacgccgtgg
tcagcggccatcgcaaaattacttaccggcgactag

DBGET integrated database retrieval system