KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_03117Help
Entry
SPAB_03117        CDS       T00628                                 

Definition
hypothetical protein
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Class
Metabolism; Overview; Carbon metabolism [PATH:spq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:spq01230]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:spq00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:spq00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2602253..2603308
Genome map
AA seq 351 aa AA seqDB search
MMSSNWVKNAINEINADHQRSADTHLIRLPLSAFPGIQLYLKDESTHPTGSLKHRLARSL
FLYGLCNGWIKEGTPIIEASSGSTAISEAWFARLLGLPFIAVMPACTAKRKIEQIQFYGG
HCHFVESACEIYAASERLAHELNGHYMDQFTYAERATDWRGNNNIADSIFRQMRNEPHPV
PRFIVMSAGTGGTSATIGRYIRCQGYDTQLMVVDPENSVFLPYWQDRDASLRSPVGSKIE
GIGRPRVEPSFIPDVVDEMLRVPDAASVATAHWLETQLGRKVGASTGTNMWGALQLAARM
REAGETGAIVTLLCDSGDRYLDTYYHPAWVSDHIGDLTPWSAAIAKLLTGD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtagcaattgggttaaaaatgccattaatgaaattaacgctgaccaccagcgt
tcagcggatacgcatcttattcgtttgcccctgtcggcatttccaggtatccagctttac
ctgaaagacgaaagcacgcatcccaccggtagcctcaagcatcgtctggcgcgctcgctg
ttcctttatgggttgtgcaatggctggattaaagaaggcactccgattattgaagcgtca
tcaggctcaacggcgatttccgaagcctggttcgcgcgtttactgggactgccgttcatc
gccgtcatgcccgcctgtaccgcaaaacgtaaaatcgaacagattcaattttacggcggc
cactgtcattttgtggagagcgcctgcgaaatttatgccgcctccgagcggctggcgcat
gaactgaacggtcactatatggaccagtttacctacgcagaacgagctaccgactggcgg
ggcaacaataatattgccgacagtattttccgccagatgcgcaacgaaccccatccggta
ccgcgatttatcgtcatgagcgccggaacgggcggaacctctgcgacgattgggcgctat
attcgctgccagggctatgatactcagctcatggtggtggatccggaaaattccgtcttt
ttaccttactggcaggatcgcgacgcttcattacgcagcccggtgggcagtaaaattgaa
ggaattggtcgtccgcgagtagagccttcttttattccggatgtcgtagatgagatgctg
cgcgtgccggacgccgccagcgttgccaccgcacactggctggaaacgcagctaggccgt
aaagtcggcgcctctaccggcacgaatatgtggggagctctgcagcttgcggcccggatg
cgcgaggctggagaaaccggcgctatcgtgacgttattgtgcgatagcggcgatcgctat
ctggatacctattaccatccggcctgggttagcgaccatatcggcgatttgacgccgtgg
tcagcggccatcgcaaaattacttaccggcgactag

DBGET integrated database retrieval system