KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_03239Help
Entry
SPAB_03239        CDS       T00628                                 

Definition
hypothetical protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Brite
Enzymes [BR:spq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SPAB_03239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2710164..2713136)
Genome map
AA seq 990 aa AA seqDB search
MMNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYDDKANIDVKMETGTG
KTYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELCT
INAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLGG
LTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNKC
VRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRGS
KIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDAI
DKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKVTFERLLKKKLTQL
IDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKNK
EKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRLP
VDENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDEAMITLIVTE
RQKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLNGETKSGFAWLLEFYPELTQARVRA
DRIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPALY
IRQKPSQVQQRLVSNEDNGRFEVAQREGELAASEFRAGMKYGHFLKQLALRTSLPVNVLH
PVLMAMLRDVLHGDSRYLSEISLDNMTRALQARINAHFAQRHDYLPLDFQASTSVFDSTA
RQFREEISAEIVGKNVDENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKLP
KRAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDMLR
RQNINVEFAEATSAPAVFSTINGLIEGKAN
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatattttactggaagaacttccccatcaggaacaggcgttagcggcgattctg
gcgagtttcaccggtatcgatcacgcgcaggccgatcataatcactatgctaatccgctg
attaaggaacgttacgacgataaggccaatattgacgttaaaatggagaccgggacgggc
aaaacctatgtctatacccggttgatgtatgaactgcatcagaagtatggcctcttcaaa
tttgtgctggtggtgccgacgccagccattaaagaaggcgcgcggaactttatcaccagc
gattacgccagacagcatttttcacagttctacgaaaatacgcggatggaactttgcacc
atcaacgccggtgattttaaagtaaagtcggggcgtaaaaattttccggcccagctatta
agttttactgatgccagccgtcgtgatagccatacgattcaggttttgctgatcaatgcg
caaatgctcaattccgccagtatgacgcgagacgattacgatcaaacgctactgggcggg
ctgacgtcgcctgttaaagggctgcaaatgacgcgaccggtggtcattattgatgaaccg
catcgttttgcgcgagataacaaattttatcgagcgattcaggccattcagccgcaaatg
atcgtccgctttggcgctaccttcccggatattgtcgaaggtaagggtaaaaataaatgt
gtacgtaaagattactatcgccggcaaccgcagtttgatctcaacgcggtggacagtttt
aacgatggtttggtgaaaggtattgatatttattacccgaatctccccgaagaacaggcc
aacaatcgttatatcgttgacagcgtcacggcaaagaaattaatcctccgacgggggagc
aaaattgccgaggttggcgtgggcgaaaatctcgccgatgtcgatgcaggatttgaaggc
agtatcgaatatgccggcagtaaaatgttgtcgaacgatctggagctggaggcagggatg
gcgctggtgccaggaacctttggcgcgagctaccaggaactgattattcaggacgctatc
gataagcattttgacactgagcaggcaaatttcttacgcagcaatgagccagaaaataat
gccccgcgtattaagaccttaagccttttctttattgacagtattaaaagctatcgtgat
gacgaaggctggttgaaagtcacttttgagcgtttgctgaaaaagaaactgacgcaactg
attgacgattatcagcgcaagaccctgccgcgagaagtggagtatctgtcgtttctgcag
gccacgctcgccagcctgcactcggataaccaaaacgtccacgctggttactttggcgaa
gaccgcggaagcggcgatgaggcgatccaggctgaggtagatgatattctgaaaaataaa
gagaagttgctcagtttttcagaccatcacggcaactgggaaacgcgccgctttctgttt
tcaaaatggacgcttcgcgaaggctgggataacccgaatgtttttgtcattgctaaatta
cgttcttccggtagcgagtcgagcaaaattcaggaagtggggcgcggcctgcggctaccg
gtagatgaaaatggtcatcgcgttcatcaggaagagtggccgtcccgactgtcgtttctg
attggttatgatgaaaaagcgtttgccagcatgctggttgatgagattaatcgcgacagc
aaagttcagcttaacgagcagaaactggatgaggcgatgatcacactcatcgtcaccgag
cggcaaaaagtcgatcctgcgtttacggagcttcgtttgctggaagatctggatgataaa
aaactgatcaaccggagtaatgagtttaaacccagcgtcacgcttaacggggaaaccaaa
agtggttttgcgtggctactggagttctaccctgagctgacgcaggcgcgggtgcgagcg
gatcgcattcgtgacaataagcccgcctcccgactgcgagtcaggttacgcaaagagaat
tgggaacaacttagcagtatctgggagcagttttcccgccgttatatgctgcaattcgag
cgtagcggcgcgtctctggaacagattgccgccgaggtgctgcgcgatccggcgctgtat
atacgccagaagccaagccaggttcaacaacggctggtatcgaatgaagataatggccgt
tttgaagtggcgcagcgggaaggcgaattagccgccagcgaatttagggcgggcatgaaa
tatggccattttcttaagcaactggcgttacgcaccagtctgccggttaacgtcctgcac
ccggtgttaatggcgatgctgcgtgatgttttgcacggagattcacgttatttaagcgag
atctcgttggacaatatgacccgcgcattacaggcgcggattaatgcgcattttgcgcag
cgccacgattatctgcctctcgattttcaggcttcaacgtcggtatttgattctacggca
cggcagttcagagaggagattagcgctgaaattgtggggaaaaatgtggatgagaatgcg
atagacgatccccgttctctctatcaaataccgccgttgcgttatgacagcgtcgatcca
gaattgccgctattaaaatacgattatccgcaacaggtttctgtgtttggcaaactgcct
aagcgggccattcagatccccaaatatacggggggctctactacgccggattttgtgtac
cgtattgagcgtcaggacgccgacagcgtttatttactggttgaaactaaagcagaaaat
atgcgcgtaggcgatcaggttattcttgatgcgcaacgtaaattcttcgatatgctgcgt
cggcaaaatattaatgtcgagtttgcggaagcgaccagcgcgccggcggtattttctacg
atcaatggcttgattgaggggaaggcaaactaa

DBGET integrated database retrieval system