KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_03640Help
Entry
SPAB_03640        CDS       T00628                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Brite
Enzymes [BR:spq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SPAB_03640 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3032576..3033166)
Genome map
AA seq 196 aa AA seqDB search
MRAQGIRDEQVLNALAAVPREKFIDEAFEHKAWENIALPIGQGQTISQPYMVARMTELLE
LTPQSRVLEIGTGSGYQTAILAHLVHHVCSVERIKGLQWQARRRLKQLDLHNVSTRHGDG
WQGWQARAPFDAIIVTAAPPEIPTALMAQLDEGGILVLPVGDEQQFLKRVRRRGGEFIID
TVEAVRFVPLVKGELA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgcgcagggcatcagagatgagcaggtgcttaatgcgcttgccgcagtgccgcgc
gagaaatttattgatgaagcgtttgaacataaggcctgggaaaatatcgctttgccgata
ggccagggtcagacgatttcgcagccctatatggtggcgcgaatgacggaactgctcgaa
ctgacgccgcaatccagggtgctggaaattggcaccggttccggctatcagacggcgatt
ctggcgcatctggtgcatcacgtttgctccgttgagcggattaaggggctgcaatggcag
gcgcgccgccgtctgaagcagctcgatttacataatgtttctacccgtcatggcgatggc
tggcaaggctggcaggcgcgtgcgccgtttgacgctatcattgtgacggccgcgccgccg
gaaattcctaccgcgctcatggcacagttggatgaaggcggcattcttgttctgcccgtg
ggcgatgagcagcagtttttgaaacgcgtgcgtcgccggggcggcgaatttattatcgat
accgtggaggccgttcgcttcgtcccgttagtcaagggagagctggcctag

DBGET integrated database retrieval system