KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_03964Help
Entry
SPAB_03964        CDS       T00628                                 

Definition
DNA topoisomerase IV subunit A
Orthology
K02621  
topoisomerase IV subunit A [EC:5.99.1.-]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Brite
Enzymes [BR:spq01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.-  
     SPAB_03964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3297305..3299563)
Genome map
AA seq 752 aa AA seqDB search
MSDMAERLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNATAKF
KKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRY
TESRLSKYAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDI
PPHNLREVAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIITPRAEIRKIYENGRGSVR
MRAVWTKEDGAVVISALPHQVSGAKVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIV
PRSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFRRDTVRR
RLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRSEDEPKPALMSRFGISETQAEAILEL
KLRHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADADAYGDDRRSPL
REREEAKAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVKGKSN
QPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLMEGDDQKLLMASDA
GYGFVCTFNDLVARNRAGKALITLPENAHVMPPLVIEDEHDMLLAITQAGRMLMFPVDSL
PQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLTIHVGKRKIKLRPEELQKVVGE
RGRRGTLMRGLQRIDRIEIDSPHRVSHGDSEE
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatggcagagcgccttgcgctacatgaatttacggaaaacgcctacttaaac
tactccatgtacgtgatcatggatcgtgcgttgccgtttattggcgacggcctgaagccg
gtacagcgccgcatcgtctatgcgatgtcagagctggggctgaacgccaccgctaaattt
aaaaaatccgcccgtaccgttggtgacgtactgggtaagtatcacccgcatggcgacagc
gcctgctatgaagccatggtgctgatggcgcagccgttctcttaccgttacccgctggtc
gatggccaggggaactggggcgcgccggatgatccgaagtcattcgcggcgatgcgttat
accgaatcccgcctgtccaaatacgccgagctgctgttaagcgaactcggtcaggggacg
gcggactgggtgccaaacttcgacggcaccatgcaggaaccgaaaatgttaccggcgcgt
ctgccgaacatcctgctgaacggcaccaccggtattgcggtgggcatggcaacagatatt
ccgccgcataacctgcgcgaagtcgcgaaagcggcgattacgctgattgagcagccgaaa
acgacgctggatcagttgctggatatcgtccaggggccggattacccgaccgaagcggag
atcattaccccacgtgcggaaattcgtaaaatttacgaaaacgggcggggctccgtgcgt
atgcgcgcggtatggaccaaagaagacggcgctgtggtaatttccgcgctgccgcatcag
gtctctggcgcgaaagtgctggagcagattgctgcgcagatgcgtaataaaaaactgccg
atggtggacgatctgcgcgatgaatcggatcacgaaaacccgacgcgtttagtgattgtg
ccacgctccaaccgtgtggatatggaacaggtgatgaaccatctgttcgccaccaccgat
ctggaaaaaagctaccgtattaacctgaacatgatcggtctggatggtcgtccggcggtg
aaaaacctgctggagatcctcaccgagtggttggcgttccgccgcgacacggtgcgccgt
cgtctgaactatcgtctggagaaagtgcttaagcgcctgcatatcctcgaaggtttgctg
gtggcgtttctcaacatcgacgaagtgattgagattatccgtagcgaagacgagccaaaa
cccgcgctgatgtcgcgtttcggcatcagcgaaacccaggcggaagcgattctcgaactg
aaactgcgccatctcgccaaactggaagagatgaaaattcgcggcgagcaggacgagctg
gaaaaagagagggaccagttgcagggcattctcgcgtccgaacgcaaaatgaataccttg
ctgaaaaaagaactacaggcggacgccgatgcctatggcgacgatcgccgttctccgctg
cgtgagcgcgaagaagctaaagcgatgagcgaacacgatatgctgccgtccgaaccggtg
actatcgtgctgtcgcagatgggctgggtgcgcagcgccaaaggtcatgatattgatgcg
ccggggcttaactataaagcgggcgacagctttaaagccgcggtgaaaggtaagagcaat
caaccggtggtgtttattgataccaccgggcgcagctatgctattgatcccattacgctt
ccgtcggcgcgtgggcagggcgagccgctgaccggcaaactcacgctgccgccgggggcg
accgtagagcatatgctgatggaaggcgatgaccagaaactgctgatggcgtcggatgcg
ggctatggcttcgtttgtacgtttaacgatctggttgcccgtaaccgtgccggtaaggcg
ttgattacactgccggaaaatgcgcacgtcatgccgccgctggtgattgaagacgagcac
gatatgctgctggcgattacccaggccggacggatgttgatgttcccggtagactctctg
ccgcagctgtcgaaaggcaaagggaataagatcattaatatcccctctgcggaagcggcg
aaaggcgatgatggactggcgcacctgtacgtgctgccgccacaaagcactctgactatc
catgtcgggaagcgcaaaatcaaactgcgccctgaagagttacaaaaggtggtcggcgaa
cgcggacgccgtggcacattaatgcgcggcctgcagcgtatcgatcgcattgagattgat
tcgccgcatcgcgtaagtcatggcgacagcgaagagtaa

DBGET integrated database retrieval system