KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_04109Help
Entry
SPAB_04109        CDS       T00628                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3423406..3424203)
Genome map
AA seq 265 aa AA seqDB search
MGILNVTPDSFSDGGAHNTLIEAVKHANLMVNAGATIIDVGGESTRPGAAEVSVEEELDR
VIPVLEAIAQRFEVWISVDTSKPEVIREAARAGAHIINDVRSLSEPGALEAAAETGLPVS
LMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEKAGIAKEKLLLDPGFGFGKNLSHN
YTLLARLGEFHHFNLPLLVGMSRKTMVGQLLNVGPSDRLNGSLACAVIAAMQGAQIIRVH
DVKETVEAMRVVEATLSAKGNKRYE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggggatcctgaacgtaacgccggattctttctccgacggcggcgcgcataacacgctg
attgaggcagtgaaacatgcgaatttaatggtgaatgccggggcgacaattattgatgtg
gggggggaatcaacgcgaccaggcgcggcggaagtgagcgtggaagaagagctggatcgc
gttattccggtactggaagcaattgcgcaacgttttgaagtgtggatttctgtggatacc
tctaaacccgaggtgatccgtgaagcggcaagggcgggcgcgcatattatcaatgatgtc
cgttcgctctccgagcccggcgcgttggaagcggcagcggaaaccggcttgccggtcagt
cttatgcacatgcagggcaaccccaaaactatgcaggaggcgccgaaatatgacgatgtc
tttgccgaggtgaatcgctactttattgagcaaatagcacgttgtgagaaggccggcatc
gcaaaagagaaattgttgctcgacccaggattcggtttcggtaaaaatctctctcacaat
tataccttactggcgcgactgggtgagtttcatcattttaacctgccgctgctggtgggc
atgtcacgtaaaacgatggttggtcagttacttaacgtgggaccatcagaccgtctgaac
ggcagccttgcgtgcgcggtaattgccgcgatgcagggcgcgcagatcattcgcgtccat
gacgtcaaagaaaccgtagaggcgatgcgggtggtggaagccactctgtctgcaaaggga
aacaaacgctatgagtaa

DBGET integrated database retrieval system