KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_04494Help
Entry
SPAB_04494        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3748763..3749869)
Genome map
AA seq 368 aa AA seqDB search
MTMLRGWITMLVMLTAINAQAACSWPAWEQFKKDYISQQGRVIDPGDARKITTSEGQSYA
MFFALAANDRPAFAQLFNWTQNNLAQGSLREHLPAWLWGQKDPDTWSVLDSNSASDGDIW
MAWSLLEAGRLWKETRYTEVGTALLKRIAREEVLNVPGLGSMLLPGKIGFAEANSWRFNP
SYLPPQLAQYFSRFGAPWSTLRETNLRLLLETAPKGFSPDWVRYESKQGWQLKAEKTLIS
SYDAIRVYLWAGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVVSGNAQGTGPVGF
SAALLPFLQNRDAQAVQRQRVADHFPGSDAYYNYVLTLFGQGWDQHRFRFTVKGELLPDW
GQECVSSR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgactatgctgcgcggatggataacgatgctcgtcatgctgacggcaataaatgcgcag
gcagcctgtagctggcctgcgtgggaacagttcaagaaagattacattagccagcaggga
cgcgttatcgatccgggcgatgcgcgaaaaattaccacctccgaagggcaaagctacgcc
atgttctttgccctggcagcgaacgatcgaccggcgttcgcgcaactgtttaactggacg
caaaacaatctggcgcagggatcgttgcgtgaacatctgcccgcctggctgtgggggcaa
aaagatcccgacacctggtcggtgctggacagcaactccgcgtccgacggcgatatctgg
atggcatggtcgctgctggaggccggtcgtctgtggaaagagacgcgttataccgaggtg
ggcacggcgttgctaaaacgcatcgcccgcgaagaggtcctgaatgtgccggggctgggc
tcaatgctgctacctggcaaaatcggctttgccgaggcgaatagctggcgttttaaccca
agctatctgccgccgcagttggcgcaatactttagccgttttggcgcgccgtggtcgacg
ttacgggaaaccaatttgcggcttttgctggaaaccgcgccgaaaggtttctcgccggac
tgggtgcgttatgaaagcaagcaaggctggcagttgaaagcggaaaagacgctgatcagt
agctacgatgcgattcgcgtctatttatgggcgggaatgatgcatgatggcgatccgcaa
aaagcgcgtttactggcgcgatttaaaccgatggcgacgttaacgatgaaaaacggcgtt
ccaccggagaaagtggatgtcgtcagcgggaatgcgcaagggacggggccggtcgggttt
tccgccgccttactgcctttcctgcaaaatcgcgacgcccaggccgtgcagcgacagcgg
gtcgcagaccattttcctggcagcgatgcctattacaactatgtgctgactctctttgga
caaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgactgg
ggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system