KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_04565Help
Entry
SPAB_04565        CDS       T00628                                 

Definition
hypothetical protein
Orthology
K00880  
L-xylulokinase [EC:2.7.1.53]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:spq00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:spq00053]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3809936..3811432
Genome map
AA seq 498 aa AA seqDB search
MSNYWLGLDCGGSWLKAGLYDGAGREVAVQRLPLHALSPQPGWVERDMTELWQQCGSVIS
KLLAHTGVSGSQIRGLGISAQGKGLFLLDKSDRPLGKAILSSDRRAMEIVQRWQKEAVPQ
KLYPLTRQTLWTGHPVSLLRWVKENEPQRYAQIGCVMMTHDYLRWCLTGVKGCEESNISE
SNLYNMATGQYDPRLTEWLGISEIDSALPPVVGSAEICGEITAQAAAITGLAAGTPVVGG
LFDVVSTALCAGIEDESTLNAVMGTWAVTSGIAHGLRDHEAHPYVYGRYVNDGQYIVHEA
SPTSSGNLEWFTAQWGDLSFDEINQAVASLPKAGSDLFFLPFLYGSNAGLEMTCGFYGMQ
ALHTRAHLLQAIYEGVVFSHMTHLNRMRERFTDVCALRVTGGPAHSDVWMQMLADVSGLR
IELPQVEETGCFGAALAARVGTGVYRDFREAQRDLQHPVRTLLPDMTAHALYQRKYRQYQ
DLITALQGYHARIKEHAL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattactggctggggttagattgtggtgggagttggctaaaagccgggttgtac
gatggcgcaggccgggaagtagcggtacaacgcctgccgctgcacgctttaagcccgcag
ccaggctgggttgaacgcgatatgaccgaactgtggcaacagtgcggctcggtcatcagc
aaactgctggcgcacacgggggtgagcggctcacaaatccgcggtctgggtatttccgct
cagggtaagggcctgttcctgttagataaaagcgatcggccattaggtaaagcgatactc
tcttccgaccgtcgcgccatggaaattgtccagcgctggcaaaaagaagcggttccgcaa
aaactctacccgctgacccgacaaactctatggaccgggcatccggtctcccttttacgc
tgggtaaaagagaatgagccgcagcgctacgcgcagataggctgcgtaatgatgacgcat
gactatctgcgctggtgcttaaccggcgtgaaaggctgtgaggagagcaacatctccgag
tccaacctctacaacatggcgacgggccagtacgacccgcgtctgaccgagtggctgggc
atcagtgaaatcgacagcgcgctgccccccgtggtgggttcagccgaaatatgcggggag
atcaccgctcaggcagccgccatcaccggtctggcggcgggtacccccgtcgtcggcggc
ctgtttgacgtggtttccaccgccctttgcgccggtattgaggatgaatcgaccctcaat
gcggtgatgggtacctgggccgtcaccagcggcatcgctcacggcctgcgcgaccatgag
gcccacccttacgtctatggccgctacgtcaatgacgggcagtatatcgttcacgaagcc
agcccgacctcttccggcaaccttgaatggttcaccgcccagtggggcgacctctctttt
gatgagatcaaccaggcggttgccagcctgccgaaagccggtagcgacctcttttttctg
ccgtttctctacggcagcaatgccggactggagatgacctgcggcttttacggcatgcag
gcgctgcacacccgcgcgcacctgctgcaggcgatttatgaaggcgtggtgttcagccat
atgacccacctcaaccgcatgcgtgaacgttttaccgacgtttgcgccctgcgcgttacc
ggcggcccggcccactccgacgtctggatgcagatgctggcggacgtcagcggtttacgc
atcgagctgccgcaggtggaggagaccggctgcttcggcgcggcgctggcagcccgcgtc
ggcaccggcgtatatcgcgatttccgcgaggcccaacgcgacctgcagcacccggtgcgc
acgctgctgccggacatgaccgcgcacgccctctaccagcgcaaataccgccaataccag
gatttgattaccgcactacagggctatcacgcccgtattaaggagcacgcattatga

DBGET integrated database retrieval system