KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_04640Help
Entry
SPAB_04640        CDS       T00628                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:spq00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3881957..3882667
Genome map
AA seq 236 aa AA seqDB search
MTKTTSHNGDVYNKPVSRLYFDNHRRKILMAQGTLYIVSAPSGAGKSSLIQALLKTQPLY
DTQVSVSHTTRAPRPGEVHGEHYFFVNHDEFKTMIGREAFLEHAEVFGNYYGTSRETIEQ
VLATGVDVFLDIDWQGAQQIREKMPQARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMA
QAVAEMSHYAEYDYLIVNDDFDTALSDLKTIIRAERLRMSRQKQRHDALISKLLAD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaagactacgtcgcataacggcgatgtgtataataagcccgtatcaaggctctat
ttcgataatcacagacgtaagatactcatggctcaaggtacgctttatattgtttctgcc
cccagtggcgcgggtaaatccagcctgattcaggctttattaaaaacccaaccgttgtat
gacactcaggtttccgtttcacataccacgcgcgcgccgcgtccgggtgaagtgcacggt
gagcactatttctttgtaaatcatgatgagtttaaaaccatgattggcagggaggcgttt
ctggagcacgcggaagtgtttggcaattactacggcacttcgcgcgaaaccattgagcaa
gtgctggcaaccggcgttgatgtttttctggatatcgactggcagggcgcccagcaaatt
cgcgaaaagatgccgcaagcacgcagcatttttattttgccgccgtcaaagatcgaattg
gatcgccgtttacgcggccgcgggcaagatagcgaagaagtcattgccaaacgaatggcg
caagcggttgcagaaatgagccattacgccgaatatgattatcttattgtgaatgacgac
tttgataccgcgttaagcgacttgaaaaccatcattcgcgctgaacgtctgcgtatgagc
cgccaaaagcagcgtcatgacgctttaatcagcaaattgttggcagactga

DBGET integrated database retrieval system