KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_04640Help
Entry
SPAB_04640        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00230  Purine metabolism
spq01100  Metabolic pathways
Module
spq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPAB_04640
Enzymes [BR:spq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SPAB_04640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase MMR_HSR1 AAA_33 AAA_22 ABC_tran AAA_29 AAA_35 Viral_helicase1 AAA_18
Motif
Other DBs
NCBI-ProteinID: ABX69953
Position
3881957..3882667
Genome map
AA seq 236 aa AA seqDB search
MTKTTSHNGDVYNKPVSRLYFDNHRRKILMAQGTLYIVSAPSGAGKSSLIQALLKTQPLY
DTQVSVSHTTRAPRPGEVHGEHYFFVNHDEFKTMIGREAFLEHAEVFGNYYGTSRETIEQ
VLATGVDVFLDIDWQGAQQIREKMPQARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMA
QAVAEMSHYAEYDYLIVNDDFDTALSDLKTIIRAERLRMSRQKQRHDALISKLLAD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaagactacgtcgcataacggcgatgtgtataataagcccgtatcaaggctctat
ttcgataatcacagacgtaagatactcatggctcaaggtacgctttatattgtttctgcc
cccagtggcgcgggtaaatccagcctgattcaggctttattaaaaacccaaccgttgtat
gacactcaggtttccgtttcacataccacgcgcgcgccgcgtccgggtgaagtgcacggt
gagcactatttctttgtaaatcatgatgagtttaaaaccatgattggcagggaggcgttt
ctggagcacgcggaagtgtttggcaattactacggcacttcgcgcgaaaccattgagcaa
gtgctggcaaccggcgttgatgtttttctggatatcgactggcagggcgcccagcaaatt
cgcgaaaagatgccgcaagcacgcagcatttttattttgccgccgtcaaagatcgaattg
gatcgccgtttacgcggccgcgggcaagatagcgaagaagtcattgccaaacgaatggcg
caagcggttgcagaaatgagccattacgccgaatatgattatcttattgtgaatgacgac
tttgataccgcgttaagcgacttgaaaaccatcattcgcgctgaacgtctgcgtatgagc
cgccaaaagcagcgtcatgacgctttaatcagcaaattgttggcagactga

DBGET integrated database retrieval system