KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_04756Help
Entry
SPAB_04756        CDS       T00628                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Brite
Enzymes [BR:spq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SPAB_04756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3967478..3968878)
Genome map
AA seq 466 aa AA seqDB search
MKKITLYATTVITVGLLCYLGLSGYVWYYDKQRSKKSDVQASVVGENNKILGYFREKGCD
YCHTPSAELPFYSSFPVAKQLMDYDIQLGYKSFNLEAVRAALIADTPVPQSELNKIEWVM
QHQTMPPTRYVALHWAGGVSDKERTDILNWIADQRERNYASADTDAAHRNEPVQPIPRNI
PVDAKKVDLGFRLYHDERLSGDSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNIEQFWDGRAATLQEQAGGPPLNPIEMASKSWDEIISKLDKDPVLKKDFQAVYPQG
FTGENITDAIAEFEKTLITPDSAFDKWLRGDENALTAQQKHGYQLFKENKCATCHGGIIL
GGRSFEPLGLKRDFNFGEITAADIGRMNVTKEVRDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGTDLPQNDIDDIVAFLESLTGVYTPYQPEYAQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaccctctatgcgacaacggttatcaccgttgggctgttatgttattta
ggtttgtccgggtatgtatggtattacgacaaacagcgcagtaaaaaaagcgatgtgcag
gcctcggttgtgggtgaaaataataaaatactgggttatttcagggagaaaggatgtgat
tattgtcatacgccttccgctgaattgcctttttattcctcttttccggtggcaaagcag
ctaatggattacgatatccagctcggttacaagtcgtttaacctggaggcggtacgggcc
gccctgattgcggatacgccggtgccgcaaagcgaactgaataaaattgaatgggttatg
caacatcagactatgccgccaacccgctatgtcgcgctgcactgggcggggggcgtcagc
gataaagagcgtactgacatcctgaactggatagccgatcagcgtgagcgcaactatgcc
agcgccgataccgacgccgcgcaccggaatgaacccgttcagcctattccgcgcaatatt
cccgtcgatgcgaaaaaagtcgacttaggtttccgtctttatcatgatgaacgtttatcc
ggcgacagcacaatatcctgtgcgcattgtcacgcgttaaatgcgggcggtgtcgatggc
agaaaaacctcaattggcgttggcggcgcggtagggccgataaatgcgccaacggtattc
aactccgtatttaatatcgaacaattttgggatggccgtgctgcaaccctgcaggagcaa
gcaggcggaccgccgttaaatcctattgaaatggcttctaaatcctgggatgaaattatt
agcaagcttgataaagatcctgtcctgaaaaaagatttccaggcggtttatccgcaagga
tttaccggggaaaatattactgatgcgatcgccgaattcgaaaaaacgttgataacgccg
gattccgcctttgataaatggctacgtggagatgaaaatgcgctgaccgcgcaacagaaa
cacggttatcaattatttaaagagaataaatgtgcaacctgtcacggcggtatcatttta
ggcggacgctcttttgaaccattgggattaaagcgagactttaattttggcgaaattacc
gcagcggatattggtcgtatgaacgtcaccaaagaggttcgcgataaattacggcaaaaa
gtcccaggcttacgcaacgtcgcgttaacagcgccttatttccatcggggcgacgtaccg
acgctggatggcgcggtaaaactgatgctgcgttaccaggttggcaccgatctgccgcaa
aacgatattgacgatatcgtcgccttcctggaaagcctgaccggtgtttatacgccatat
caacctgaatatgcgcaatga

DBGET integrated database retrieval system