KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_04914Help
Entry
SPAB_04914        CDS       T00628                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spq00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4111227..4112327
Genome map
AA seq 366 aa AA seqDB search
MPQYATAAVLCQARRKKRFYLVNEAENPMFQQQNDWETRENAFAAFAMGPLTDFWRQREE
AEFIGVGNIPVRFVRFRNDSNDRTIVICPGRIESYVKYAELAYDLFHLGFDIFIIDHRGQ
GRSGRMLSDPHRGHVDHFNDYVEDLAAFWQQEIEPGPWRKRYILAHSMGGAIATLFLQRH
RVRCDAIALTAPMFGIVIRLPSFMVRHILDWAEGHQRIREDYAIGTGQWRALPFGMNALT
HSRQRYQRNLRFYADEPQLRVGGPTWHWVREGILAGEQVLAGASDDTTPTLLIQAEEERV
VDNRTHDRFCEIRAAAGYPCEGGKPLVIKGAYHEILFEKDAMRSVALNAIVEFFNKPNLS
SGNRFA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgccacaatacgctactgccgctgtgttgtgtcaggcacgacgcaaaaaacgattttac
ctggtaaacgaggccgaaaacccgatgtttcagcagcaaaatgactgggaaacaagagaa
aatgcgtttgccgcttttgctatggggccgctgaccgatttctggcgtcagcgggaagag
gcggagtttatcggcgtgggtaacattccggtgcgctttgtccgttttcgaaatgattcc
aacgatcggacgatcgtcatttgtcctggccgcattgagagttatgtaaaatacgctgaa
ctggcgtatgacctttttcatctcggttttgatatcttcatcatcgaccaccgtggtcaa
gggcgctccgggcggatgttatcggacccgcatcggggccacgttgatcattttaacgat
tatgttgaggacttagcggcgttctggcagcaggaaattgagccggggccgtggcgtaag
cgttatatcctggcgcactcaatggggggcgcgatagccactctgttcctgcaacgccat
cgtgttcggtgcgacgctattgcgctcaccgcgccgatgtttggtattgtgatacgcttg
ccttcctttatggtgcgccatattctcgactgggccgaggggcaccagcgtatccgtgaa
gattacgctattggtaccggtcagtggcgggcgttgccgtttgggatgaatgcgctgacc
cacagccgccagcgttatcagcgcaacttacgattttatgccgacgagccgcaactgcgc
gttggcggccccacctggcattgggtacgcgaaggcattctggcgggtgagcaggtactg
gccggggcgagcgatgacacgacgcctacgctactgattcaggcggaagaagagcgggta
gtggataaccgcacccacgatcgtttttgtgaaattcgcgccgcggcgggatacccttgt
gaagggggaaaaccgctggttatcaaaggcgcgtaccatgagatcctttttgaaaaggac
gccatgcgctcagtcgcgcttaacgccattgttgaatttttcaacaagcctaatttatcc
agcggaaatcgctttgcttag

DBGET integrated database retrieval system