KEGG   Streptococcus pneumoniae R6 (avirulent): spr0059Help
Entry
spr0059           CDS       T00060                                 

Gene name
bgaC
Definition
beta-galactosidase 3 (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    spr0059 (bgaC)
Enzymes [BR:spr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     spr0059 (bgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65845..67632
Genome map
AA seq 595 aa AA seqDB search
MTRFEIRDDFYLDGKSFKILSGAIHYFRIPPEDWYHSLYNLKALGFNTVETYVAWNLHEP
REGEFHFEGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGLPAWLLTKNMRIRSSDP
AYIEAVGRYYDQLLPRLVPRLLNNGGNILMMQVENEYGSYGEDKAYLRAIRQLMEECGVT
CPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQEFFDEHGKKWPLMCMEFW
DGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGANFGFMNGCSARGTLDLPQV
TSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLYKESMELDAIPLVEKVSLFET
LDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEERLRIIDGRDRAQLYVDGQWVK
TQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHKFLADTQRKGIRTGVCKDLHFLL
NWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEEPKDTYLDLSEFGKGVAFVNGQNL
GRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYKEEIHLTRKPTLKHIKGENL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacacgatttgagatacgagatgatttctatctcgatggaaaatcatttaagatttta
tctggtgccattcattattttaggattcctccagaggattggtatcattcgctctataac
ttgaaggctcttggttttaatacggtagagacttatgttgcttggaatttacacgagcct
cgtgaaggtgagtttcattttgaaggtgatctggatttagagaaatttctccaaatagcg
caggatttgggtctctacgcaattgtgcgtccgtctccatttatctgtgcggaatgggaa
ttcggtggcttaccagcttggctcttgaccaagaacatgcgaattcgctcatccgaccca
gcatatatcgaggcagttggtcgctactatgatcagttattgccaagactggtgcctcgt
ttgttgaacaatggtggcaatattctcatgatgcaggttgaaaatgagtatggttcttac
ggagaagataaggcttacctgagagcgattcgacagctaatggaagagtgtggcgtaacc
tgtcccctctttacatcagatggtccatggcgagctactctgaaagctggaaccttaatt
gaagaggacctctttgtaacaggaaactttggttctaaggcaccttacaacttttcgcag
atgcaggaattctttgatgaacatggtaagaaatggccactcatgtgtatggagttctgg
gatggttggttcaatcgctggaaagaaccgattatcacacgggatcctaaggaattggca
gatgcagttcgagaggttttggaacaaggctctatcaatctttacatgttccacggtggt
gcaaactttggtttcatgaatggttgctcagctcgaggaactttggacctgccacaagtt
acatcttatgattacgatgcccttctggatgaagaaggaaatccaactgctaaatatctt
gcagtcaagaagatgatggcaacacatttttcagagtatccgcagttggaaccactctac
aaagagagtatggagttggatgctattccactagttgaaaaagtttctttgtttgaaacc
ttagatagcttgtcaagtcctgtagaaagtctctatcctcaaaagatggaggagctggga
caaagttatggctacctactttatcgaacagaaacaaactgggatgcagaagaagaaaga
cttcgtatcattgatggtcgagatagggcccagctgtatgtcgatggtcagtgggttaaa
actcaatatcagacagagattggggaagatattttttatcaaggtaaaaagaaagggcta
tctaggttagatatcttgatagaaaatatggggcgtgtcaactatgggcataagttctta
gcggatacgcaacgtaagggaattcggacaggggtctgtaaggatctgcatttcttacta
aactggaaacactatccactcccactagacaatcctgagaaaattgatttttcaaaagga
tggactcaaggacaaccagccttttacgcttatgactttacagtcgaagagccaaaagat
acttacctagacttgtctgagtttggtaagggagttgcctttgtcaatgggcagaatcta
ggacgtttttggaacgttggcccaactctctcactttatatccctcatagctatctcaag
gaaggtgccaaccgtatcattatctttgaaacagaaggtcaatataaagaagagattcat
ttaactcgtaaacctacactaaaacatataaagggggaaaacttatga

DBGET integrated database retrieval system