KEGG   Streptococcus pneumoniae R6 (avirulent): spr0165Help
Entry
spr0165           CDS       T00060                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    spr0165 (ruvA)
Enzymes [BR:spr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     spr0165 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
174163..174756
Genome map
AA seq 197 aa AA seqDB search
MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEAQIYVHQVVREDAHLLY
GFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETKNITYLTKFPKIGKKTA
QQMVLDLEGKVVVAGDGLPAKVAVQASAENQELEEAMEAMLALGYKATELKKIKKFFEGT
TDTAENYIKSALKMLVK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatatttaaaaggaatcattaccaaaattactgccaaatacattgttcttgaa
accaatggtattggttatatcctgcatgtggccaatccttatgcctattcaggtcaggtt
aatcaggaggctcagatttatgtgcatcaggttgtgcgtgaggacgcccatttgctttat
ggatttcgctcagaggatgagaaaaagctctttcttagtctaatttcggtctctgggatt
ggtcctgtatcagctcttgctattatcgctgctgatgacaatgctggcttggttcaagcc
attgaaaccaagaacattacctacttgaccaagttccctaaaattggcaagaaaacagcc
cagcagatggtgctggacttggaaggcaaggtagtagttgcaggagatggccttcctgcc
aaggtcgcagtgcaagcaagtgctgaaaaccaagaattggaagaagctatggaagccatg
ttggctctgggctacaaggcaacagagctcaagaaaatcaagaaattctttgaaggaacg
acagatacagctgagaactatatcaagtcggcccttaaaatgttggtcaaatag

DBGET integrated database retrieval system