KEGG   Streptococcus pneumoniae R6 (avirulent): spr0244Help
Entry
spr0244           CDS       T00060                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spr0244 (bglA)
Enzymes [BR:spr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     spr0244 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238727..240106
Genome map
AA seq 459 aa AA seqDB search
MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYYNGIGSDKTSTFYENW
ERDIELLLETGHTVFRTSIQWSRIFPQGCGKVNPQGVDFYRKVFEAIKAKGIRLLVNLYH
FDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWITFNEPIVPVEFGYFYDAH
YPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLNLTPAYPRSQHPADVKAAR
IAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEELELIRDNTVDFLGVNYYQPL
RVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIYEQGIYDIAQNIKENYGNIEW
MLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHRAIEDGANCKGYLIWTFIDCWS
WLNSYKNRYGLVELDLETQERRLKKSGHWFKELSDNNGF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctaagatttccaaaggattttgtctggggatcctctacttctggaccgcagacagaa
ggacgtgtagctggtgacggtaagggagacaatctctgggattactggttccaagtggag
ccaaatcgttactataatgggattggttcagataagacatcgactttttatgaaaattgg
gagcgggatattgagcttttgttagagactggtcacacagtctttcggacttctattcag
tggtcacggatttttccacaaggctgtggaaaagtcaaccctcaaggtgtggatttttat
cgtaaggtctttgaggctattaaggctaaaggaattcgtctgttagtcaatctctatcat
tttgatttaccttttgcccttcaagaggatggtgatggttgggaaaataaggcgacagtc
tcagcctatgaagactatgctcgtttttgttttgagacttatggagatttagtggatcaa
tggattacctttaacgagcccatcgttcctgtagaatttggttatttttatgatgcccat
tatccacataaggtggatgcagaggcagctgttaaggtagcctatcatacacaattggcc
agcagccgggctgttaaggcttgccatgaacttttgcctgattccaagattgggattgtc
ctcaacttgacaccggcttatccacgtagccagcatcctgctgatgtcaaggcagctcgt
attgcggccctttttcaggcccaatctttcttagatccatctgtcttggggacttatcca
caggagttggtagaaatcttgcatgaacacggtcttttacctgatgctacagaggaagag
ttggaactcattcgtgataatacggtggacttccttggtgtgaactactatcaacctttg
cgtgttatggctcctcgatttgctaagcatccagagagtccactcttaccagaacatttt
tacgagccttatgtgatgcctggacgtaaaatcaattctcatcgtggttgggagatttat
gagcaagggatttatgacatcgcccaaaatatcaaggaaaattatggcaatattgagtgg
atgttgactgagaatggtatgggtgttgaaggggaagaaaaattccgtcaagatggaatg
attcaagatgattaccgtattgactttgtaaaaggtcatcttcgtgaacttcaccgtgcc
attgaagatggtgccaactgtaagggctacttgatttggacctttattgactgctggtca
tggctcaacagctataaaaatcgctatggtttggtcgaattagacttggaaacgcaagaa
cgtcgtctgaagaaatcaggccactggttcaaagaattaagcgataataatggattttaa

DBGET integrated database retrieval system