KEGG   Streptococcus pneumoniae R6 (avirulent): spr0285Help
Entry
spr0285           CDS       T00060                                 

Gene name
basA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    spr0285 (basA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    spr0285 (basA)
Enzymes [BR:spr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     spr0285 (basA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(284437..284913)
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGLQELYERYQDQGFEIL
DFPCNQFMGQAPGSAEEINTFCSLHFQTTFPRFAKIKVNGKEADPLYVWLKDHKSGPLGK
RIEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactttatgatttttccgttttgaaccaaaacaaccaagcaactcccttggat
agctatcgtggcaaagttctcttgattgtcaacactgctactggatgtggtttaacgccc
cagtaccagggacttcaagaactctatgaacgctatcaagatcagggcttcgaaatattg
gatttcccttgcaatcagtttatgggacaagcacccggcagcgcagaggaaatcaacacc
ttctgtagcctacattttcaaaccaccttcccacgttttgccaagattaaggtcaacggt
aaggaagcagaccctctctatgtctggttaaaagaccataaatctggcccactaggaaaa
cgaatcgaatggaatttcgctaagtttctcattggtcgtgatgggcaagtctttgaacgc
ttttcttcaaaaacagacccaaaacaaattgaagaggcgatacaaactctactataa

DBGET integrated database retrieval system