KEGG   Streptococcus pneumoniae R6 (avirulent): spr0321Help
Entry
spr0321           CDS       T00060                                 

Gene name
cps2M
Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    spr0321 (cps2M)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    spr0321 (cps2M)
Enzymes [BR:spr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     spr0321 (cps2M)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321134..321727
Genome map
AA seq 197 aa AA seqDB search
MTDNFFGKILAVRKIDAIPGMLEFDIPVHGDNRGWFKENFQKEKMEPLGFPESFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGETFGNTYQTIIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPSLGIEWENIAEAEVSEAD
KHHPLLKDVKPLKKEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagataattttttcggaaaaatacttgcggtgcgtaaaattgatgccattccaggt
atgttagagtttgatatcccagttcatggtgacaatcgtggctggtttaaggaaaatttc
cagaaggaaaagatggagccacttggctttcctgaaagcttctttgctgaagggaaacta
caaaataacgtcagcttttctcgcaaaaatgtccttcgaggcctccacgcagagccttgg
gataagtacatctctgtagcagatggagggaaagttctgggttcttgggttgatctacgc
gagggtgaaacctttgggaatacctatcagacaataattgatgcaagcaagggaatcttt
gttcctcgaggcgtagctaatggcttccaagttttatcagatacagtgtcatatagctat
ctggtcaatgattattgggctcttgaactcaaacccaagtatgcctttgtgaactacgct
gatccaagccttggtattgaatgggaaaatattgcagaagcagaggtttcagaagcagat
aaacatcatcccctacttaaggatgtaaaacctttgaaaaaagaagatttgtaa

DBGET integrated database retrieval system