KEGG   Streptococcus pneumoniae R6 (avirulent): spr0363Help
Entry
spr0363           CDS       T00060                                 

Gene name
recD
Definition
exonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    spr0363 (recD)
Enzymes [BR:spr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     spr0363 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(361275..363641)
Genome map
AA seq 788 aa AA seqDB search
MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTGTMADVIEGEDYTFWG
QIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTAQKIVDTYGENTIDEIL
QHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMVLAKLANYGIPNKLAFQIQDFYKEETLD
VVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGLVHSLFQACMETGDTYVEA
RDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQIDTKIFDNSLFFAEEGIRSHL
IRILEKGEQKRQDLETIQKHITTVEQELGIEYDNIQKQAICDAIQNKVFILTGGPGTGKT
TVINGIIAVYALLEGLDFRKKSNLPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDD
DTSHLEDYLDAEFIIVDEFSMVDTWLANQLFSNISSNSKILIVGDSDQLPSVSPGQVLAD
LLHIPLIPQTRLEKIYRQSKESTIVTLASQIRQGILPADFTQKKADRSYFEIASGHIPAT
IEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQLMQDLLNPPQKDQLSFEAPQCHYR
KRDKVIHLVNDAEINVFNGDLGAITDLIPGKYTESKQDEIVIDFDSNEVSYPRNEWYKIR
LAYAMSIHKSQGSEFPVVILPITSASRRMLERNLIYTAITRAKSKLILLGELQAFDYATQ
HIGTARKTYLIERFSDLLENVEEKQQAVSETVTSSASEQSYILTEENWDRIPAMIGITDT
DLKEIFGK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatttttcaggaaccattgaacggattatttttgaaaatcccagcaatttt
tatcgcatcctcctcctagaaatcgacgatacggacgcagaggattttgatgattttgaa
atcattgtcacaggaaccatggctgatgtaattgagggcgaagactatactttttggggg
caaattgtccagcactccaagtatggagaacaactgcaaatcagtcgttatgatcgcgca
aaaccaactagtaagggcttggtcaagtacttttcaagtagccatttcaaggggattggt
ctcaagacagctcagaaaatcgtggatacctatggcgaaaataccattgacgaaattttg
caacacccagaaaagttagaaggcatcgcaggactctctgccaaaaatcgcgaggctttc
gtctccactctccgtctcaactacggtacggagatggttttggccaaactagccaactac
ggcattcccaacaaactagcctttcagattcaagacttttacaaggaagaaacccttgat
gtggttgaaaattatccctaccagctggttgaggatatcaagggtttgggctttaccatt
gctgaccaactagctgaggaactaggcatcgaaagtcaggctcctgaacgcttccgcgcc
ggtctagttcacagtctttttcaggcctgtatggaaacaggggacacctatgttgaagca
cgggatttgctggaacaaacccttactctccttgagtcttcccgtcccgtggaactagac
cccagccaagttgcccaagagctctcctacctgatcgaagaagacaaggttcagcagatt
gataccaagatctttgacaacagcctctttttcgctgaggaaggtatccgcagtcacttg
attcgtatccttgaaaaaggagaacagaagagacaagatttagaaactattcaaaagcat
atcactactgtcgagcaagaactggggattgagtatgataacattcaaaaacaagctatt
tgtgacgctatccagaacaaggtctttatcctgacaggtgggcctggtactggtaagaca
actgttatcaatggaatcatcgctgtttatgcccttttagaaggacttgacttcaggaag
aaaagcaatctgcccattcttcttgctgctccaactggtcgagctgctcgtcgcatgaat
gaattgacaggtttgcctagcgcgaccatacatcgccacttgggaatgacaggtgacgat
gataccagtcatctggaagattacctagatgctgagtttatcatcgtggatgaattctct
atggtagatacttggctggccaatcaactcttctccaatatctcttctaacagtaagatc
ctcatcgtaggtgacagtgatcagctaccttctgtcagtcctggacaggttctagcggat
ctgcttcatattcctttgattcctcagactcgcttggaaaaaatttatcgacaaagcaaa
gaatcaaccatcgtcaccctagctagtcagattcgacagggcatcttgccagctgatttc
acccaaaaaaaagctgaccgttcctactttgaaattgctagtggccatattcctgccacc
attgaaaaaatcttaggtgccgccctcagaaatggtattcccgcccgtgatatccaagtt
ctggctcctatgtaccgagggacggcagggattgatgctatcaatcagctcatgcaagac
ctgctcaatcccccacaaaaagatcaactcagttttgaagctcctcagtgtcactatcgt
aagagagacaaggtcattcatttggttaacgatgctgaaatcaatgtctttaatggggat
ttaggagctatcacagacctgattcctggtaaatacaccgaatcgaaacaagacgagatt
gtcattgattttgatagtaatgaagtctcttacccccgtaacgaatggtacaagattcgc
ttggcctatgccatgagtattcataagtctcagggaagtgagttcccagttgtcatccta
ccgattactagtgctagccgacgtatgctggagcgaaatctcatctacacagccattaca
cgtgccaaaagcaaactcatcttactaggcgaattacaagccttcgactatgctacccaa
cacatcggaactgcccgaaaaacctatctgattgaacgcttcagtgatctactggagaat
gttgaagaaaagcaacaagctgtctctgaaacagtcacatcaagtgcctctgaacaatcc
tacatcctaaccgaagaaaactgggaccgcatcccagccatgattgggattacagacaca
gacctcaaagagatttttggaaaatag

DBGET integrated database retrieval system