KEGG   Streptococcus pneumoniae R6 (avirulent): spr0796Help
Entry
spr0796           CDS       T00060                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00010  Glycolysis / Gluconeogenesis
spr00030  Pentose phosphate pathway
spr00051  Fructose and mannose metabolism
spr00052  Galactose metabolism
spr00680  Methane metabolism
spr01100  Metabolic pathways
spr01110  Biosynthesis of secondary metabolites
spr01120  Microbial metabolism in diverse environments
spr01130  Biosynthesis of antibiotics
spr01200  Carbon metabolism
spr01230  Biosynthesis of amino acids
spr03018  RNA degradation
Module
spr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spr0796 (pfkA)
   00030 Pentose phosphate pathway
    spr0796 (pfkA)
   00051 Fructose and mannose metabolism
    spr0796 (pfkA)
   00052 Galactose metabolism
    spr0796 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    spr0796 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    spr0796 (pfkA)
Enzymes [BR:spr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     spr0796 (pfkA)
Protein phosphatases and associated proteins [BR:spr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     spr0796 (pfkA)
Messenger RNA biogenesis [BR:spr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     spr0796 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-GeneID: 934334
NCBI-ProteinID: NP_358390
UniProt: Q8DQ85
Position
799177..800184
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIATGADEIIIPEAGFKMEDIVASIKAGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDI
SDLRVTELGHIQRGGSPTPRDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGT
AEEGALFSLTAEGKIVVNNPHEADIELSSLNKSLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggagacgcacctggtatgaacgctgccatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagtgtttggtatctatgacgga
tatgctggtatggttgccggtgaaattcatcccctagatgcagcttcagtaggggacatc
atttctcgtggtggtacttttcttcactcagctcgttatccagagttcgctcaacttgaa
gggcaacttaaagggattgagcaattgaaaaaacacggaattgaaggtgtagttgttatc
ggtggtgacggatcttaccacggcgctatgcgtttgactgaacatggcttcccagctatt
ggtcttccaggtacaatcgataacgatatcgttggtactgactttacaatcggttttgac
acagcggttactactgccatggacgctatcgataagattcgtgatacatcatcaagtcac
cgtcgtacttttgtaatcgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcaactggtgctgatgaaatcatcatccctgaagcaggcttcaagatggaagat
atcgtagcaagcatcaaagctggttatgaatgtggtaaaaaacacaatatcatcgtctta
gctgaaggtgtgatgtcagcggctgaatttggtcaaaaacttaaagaagctggagatata
agcgaccttcgtgtaacagaacttggacatattcaacgtggtggttctccaactccgcgt
gaccgtgttttggcgtcacgtatgggtgcacatgctgttaaacttcttaaagaaggtatc
ggtggtgttgcggttggtattcgtaacgaaaaaatggttgaaaatccaattcttggtact
gcagaagaaggggcattgtttagccttactgcagaaggtaagattgtggttaacaaccca
cacgaagccgatattgagctatctagcttgaataagagcttgtcataa

DBGET integrated database retrieval system