KEGG   Streptococcus pneumoniae R6 (avirulent): spr0796Help
Entry
spr0796           CDS       T00060                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    spr0796 (pfkA)
   01230 Biosynthesis of amino acids
    spr0796 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spr0796 (pfkA)
   00030 Pentose phosphate pathway
    spr0796 (pfkA)
   00051 Fructose and mannose metabolism
    spr0796 (pfkA)
   00052 Galactose metabolism
    spr0796 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    spr0796 (pfkA)
Enzymes [BR:spr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     spr0796 (pfkA)
Protein phosphatases and associated proteins [BR:spr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     spr0796 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
799177..800184
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIATGADEIIIPEAGFKMEDIVASIKAGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDI
SDLRVTELGHIQRGGSPTPRDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGT
AEEGALFSLTAEGKIVVNNPHEADIELSSLNKSLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggagacgcacctggtatgaacgctgccatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagtgtttggtatctatgacgga
tatgctggtatggttgccggtgaaattcatcccctagatgcagcttcagtaggggacatc
atttctcgtggtggtacttttcttcactcagctcgttatccagagttcgctcaacttgaa
gggcaacttaaagggattgagcaattgaaaaaacacggaattgaaggtgtagttgttatc
ggtggtgacggatcttaccacggcgctatgcgtttgactgaacatggcttcccagctatt
ggtcttccaggtacaatcgataacgatatcgttggtactgactttacaatcggttttgac
acagcggttactactgccatggacgctatcgataagattcgtgatacatcatcaagtcac
cgtcgtacttttgtaatcgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcaactggtgctgatgaaatcatcatccctgaagcaggcttcaagatggaagat
atcgtagcaagcatcaaagctggttatgaatgtggtaaaaaacacaatatcatcgtctta
gctgaaggtgtgatgtcagcggctgaatttggtcaaaaacttaaagaagctggagatata
agcgaccttcgtgtaacagaacttggacatattcaacgtggtggttctccaactccgcgt
gaccgtgttttggcgtcacgtatgggtgcacatgctgttaaacttcttaaagaaggtatc
ggtggtgttgcggttggtattcgtaacgaaaaaatggttgaaaatccaattcttggtact
gcagaagaaggggcattgtttagccttactgcagaaggtaagattgtggttaacaaccca
cacgaagccgatattgagctatctagcttgaataagagcttgtcataa

DBGET integrated database retrieval system