KEGG   Streptococcus pneumoniae R6 (avirulent): spr0989Help
Entry
spr0989           CDS       T00060                                 

Gene name
murZ
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:spr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
973796..975055
Genome map
AA seq 419 aa AA seqDB search
MRKIVINGGLPLQGEITISGAKNSVVALIPAIILADDVVTLDCVPDISDVASLVEIMELM
GATVKRYDDVLEIDPRGVQNIPMPYGKINSLRASYYFYGSLLGRFGEATVGLPGGCDLGP
RPIDLHLKAFEAMGATASYEGDNMKLSAKDTGLHGASIYMDTVSVGATINTMIAAVKANG
RTIIENAAREPEIIDVATLLNNMGAHIRGAGTNIIIIDGVERLHGTRHQVIPDRIEAGTY
ISLAAAVGKGIRINNVLYEHLEGFVAKLEEMGVRMTVSEDSIFVEEQSNLKAINIKTAPY
PGFATDLQQPLTPLLLRANGRGTIVDTIYEKRVNHVFELAKMDADISTTNGHILYTGGRD
LRGASVKATDLRAGAALVIAGLMAEGKTEITNIEFILRGYSDIIEKLRNLGADIRLVED
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgttatcaatggtggattaccactgcaaggtgaaatcactattagtggt
gctaaaaatagtgtcgttgccttaattccagctattatcttggctgatgatgtggtgact
ttggattgcgttccagatatttcggatgtagccagtcttgtcgaaatcatggaattgatg
ggagctactgttaagcgttatgacgatgtattggagattgacccaagaggtgttcaaaat
attccaatgccttatggtaaaattaacagtcttcgtgcatcttactatttttatgggagc
ctcttaggccgttttggtgaagcgacagttggtctaccgggaggatgtgatcttggtcct
cgtccgattgacttacaccttaaggcgtttgaagctatgggtgccactgctagctacgag
ggagataacatgaagttatctgctaaagatacaggacttcatggtgcaagtatttacatg
gatacggttagtgtgggagcaacgattaatacgatgattgctgcggttaaagcaaatggt
cgtactattattgaaaatgcagcccgtgaacctgagattattgatgtagctactctcttg
aataatatgggtgcccatatccgtggggcaggaactaatatcatcattattgatggtgtt
gaaagattacatgggacacgtcatcaggtgattccagaccgcattgaagctggaacatat
atatctttagctgctgcagttggtaaaggaattcgtataaataatgttctttacgaacac
ctggaagggtttgttgctaagttggaagaaatgggagtgagaatgactgtatctgaagac
agcatttttgtcgaggaacagtctaatttgaaagcaatcaatattaagacagctccttac
ccaggctttgcaactgatttgcaacaaccgcttacccctcttttactaagagcgaatggt
cgtggtacaattgtcgatacgatttacgaaaaacgtgtaaatcatgtttttgaactagca
aagatggatgcggatatttcgacaacaaatggtcatattttgtacacgggtggacgtgat
ttacgtggggccagtgttaaagcgaccgacttaagagctggggctgcactagtcattgct
gggcttatggctgaaggcaaaactgaaattaccaatatcgagtttatcttacgtggttat
tctgatattatcgaaaaattacgtaatttaggagcggatattagacttgttgaggattaa

DBGET integrated database retrieval system