KEGG   Streptococcus pneumoniae R6 (avirulent): spr1049Help
Entry
spr1049           CDS       T00060                                 

Gene name
acoC
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00010  Glycolysis / Gluconeogenesis
spr00020  Citrate cycle (TCA cycle)
spr00620  Pyruvate metabolism
spr01100  Metabolic pathways
spr01110  Biosynthesis of secondary metabolites
spr01120  Microbial metabolism in diverse environments
spr01130  Biosynthesis of antibiotics
spr01200  Carbon metabolism
Module
spr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spr1049 (acoC)
   00020 Citrate cycle (TCA cycle)
    spr1049 (acoC)
   00620 Pyruvate metabolism
    spr1049 (acoC)
Enzymes [BR:spr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     spr1049 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase
Motif
Other DBs
NCBI-GeneID: 934073
NCBI-ProteinID: NP_358643
UniProt: Q8DPQ9
Position
complement(1044023..1045066)
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPDNVTPYGKIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMSLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSSTIEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgacaagctaagagcgactcctgcagctagaaagttagcggatgatttaggg
ataaacctctacgacgtttctggctcaggtgcaaacggtcgtgtccacaaagaagacgtg
gaaacttataaagacacaaacgtggttcgcatttcgccacttgcaaaacgaattgccctc
gaacataacattgcttggcaggaaatccaaggaaccggtcatcgtggtaaaatcatgaag
aaggatgttttggccctgcttcctgaaaatatcgaaaacgatagcatcaaatctcctgct
cagattgaaaaagtggaagaagtccctgataacgtaacaccatatggtaaaatcgagcgt
attccaatgacaccaatgcgtaaggttattgcccaacgcatggttgaatcttacttgact
gcgccaaccttcaccctcaactatgaagttgatatgactgaaatgttggctcttcgtaag
aaggttcttgagccaatcatggaagcaactgggaagaagactactgtaacagaccttctt
tcgcttgcagttgttaagactcttatgaaacacccatacatcaacgcttcattgacagaa
gatggcaagactattatcactcacaactatgtcaatcttgccatggcagttgggatggat
aatggattgatgacacctgttgtttacaatgctgagaagatgagtctttcagaactggtt
gtagcctttaaggatgttattggccgtaccttggatggtaaattggctccaagtgagtta
caaaattcaacattcacaatcagtaatttgggaatgtttggtgttcagtcctttggtccg
attattaaccaacccaactcagctatccttggtgtcagttcgacaatcgagaagccagtt
gtcgtcaatggtgaaattgtgattcgcccaatcatgagtttaggattaaccattgaccac
cgtgtcgtagatggtatggctggtgctaagtttatgaaggacttgaaagagttgattgaa
acgccaatctcaatgttaatttaa

DBGET integrated database retrieval system