KEGG   Streptococcus pneumoniae R6 (avirulent): spr1155Help
Entry
spr1155           CDS       T00060                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00240  Pyrimidine metabolism
spr00250  Alanine, aspartate and glutamate metabolism
spr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    spr1155 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    spr1155 (pyrB)
Enzymes [BR:spr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     spr1155 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 933189
NCBI-ProteinID: NP_358748
UniProt: Q8DPH9
Position
complement(1159367..1160290)
Genome map
AA seq 307 aa AA seqDB search
MSENQQALNHVVSMEDLTVDQVMKLIKRGIEFKNGAQIPYEDHPIVSNLFFEDSTRTHKS
FEVAEIKLGLERLDFDVKTSSVNKGETLYDTILTLSALGVDVCVIRHPEVDYYRELIASP
TITTSIINGGDGSGQHPSQSLLDLMTIYEEFGHFEGLKVAIAGDLDHSRVAKSNMQILKR
LGSELFFAGPEEWRSQEFADYGKFVTIDEIIDQVDVMMFLRVQHERHDSGAVFSKEDYHA
QHGLTQERYDRLKETAILMHPAPINRDVEIADHLVEAPKSRIVQQMTNGVFVRMAILESV
LASRNAN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatcaacaagcattgaaccatgtggtgtccatggaagacctcactgttgat
caagtaatgaaattgatcaagcgaggaattgagtttaaaaatggagcccagattccctat
gaagaccatccgattgtttccaatctcttctttgaggattctacacggacacataagtcc
tttgaagtcgcagagattaaacttggattggaacgacttgactttgatgtgaagactagt
tcggttaataagggtgagacactttatgataccattttgactctgtctgctttaggagtg
gatgtctgtgtgattcgccatccagaggtcgactactatagagaattgattgctagtcca
acgattacgacttccatcatcaatggtggagatggttcgggccaacaccctagccagagc
ttgcttgatttgatgaccatttatgaggaatttggccactttgagggtcttaaagttgct
attgcaggtgacttggaccactcacgcgttgccaaatccaatatgcagattttgaaacgc
ttgggatctgaactctttttcgctggacctgaggaatggagaagtcaagagtttgcagac
tatggaaagtttgtaaccattgatgaaatcattgatcaggttgatgtcatgatgtttctc
cgtgtgcaacacgaacgccatgatagtggagctgtattttcaaaagaagactaccatgcc
caacatggcttgactcaagaacgttacgatcgtttgaaagaaacagcaatcctcatgcac
ccagctccaatcaatcgtgatgtagaaatagcagaccacttggttgaagcaccaaaatca
cggattgtccaacaaatgaccaatggtgtctttgttcgaatggcaatcttagaatccgta
ctagcgagtagaaacgccaactaa

DBGET integrated database retrieval system