KEGG   Streptococcus pneumoniae R6 (avirulent): spr1431Help
Entry
spr1431           CDS       T00060                                 

Gene name
lytC
Definition
1,4-beta-N-acetylmuramidase (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Brite
Enzymes [BR:spr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     spr1431 (lytC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1414511..1416016)
Genome map
AA seq 501 aa AA seqDB search
MSVTFFIGEERLKIKIGLASICLLGLATSHVAANETEVAKTSQDTTTASSSSEQNQSSNK
TQTSAEVQTNAAAYWDGDYYVKDDGSKAQSEWIFDNYYKAWFYINSDGRYSQNEWHGNYY
LKSGGYMAQNEWIYDSNYKSWFYLKSDGAYAHQEWQLIGNKWYYFKKWGYMAKSQWQGSY
FLNGQGAMIQNEWLYDPAYSAYFYLKSDGTYANQEWQKVGGKWYYFKKWGYMARNEWQGN
YYLTGSGAMATDEVIMDGARYIFAASGELKEKKDLNVGWVHRDGKRYFFNNREEQVGTEH
AKKIIDISEHNGRINDWKKVIDENKVDGVIVRLGYSGKEDKELAHNIKELNRLGIPYGVY
LYTYAENETDAENDAKQTIELIKKYNMNLSYPIYYDVENWEYVNKSKRAPSDTDTWVKII
NKYMDTMKQAGYQNVYVYSYRSLLQTRLKHPDILKHVNWVAAYTNALEWENPYYSGEKGW
QYTSSEYMKGIQGRVDVSVWY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttacattttttataggagaggaaagattgaaaataaaaattggattagcaagt
atctgtttactaggcttggcaactagtcatgtcgctgcaaatgaaactgaagtagcaaaa
acttcgcaggatacaacgacagcttcaagtagttcagagcaaaatcagtcttctaataaa
acgcaaacgagcgcagaagtacagactaatgctgctgcctactgggatggggattattat
gtaaaggatgatggttctaaagctcaaagtgaatggatttttgacaactactataaggct
tggttttatattaattcagatggtcgttactcgcagaatgaatggcatggaaattactac
ctgaaatcaggtggatatatggcccaaaacgagtggatctatgacagtaattacaagagt
tggttttatctcaagtcagatggggcttatgctcatcaagaatggcaattgattggaaat
aagtggtactacttcaagaagtggggttacatggctaaaagccaatggcaaggaagttat
ttcttgaatggtcaaggagctatgatacaaaatgaatggctctatgatccagcttattct
gcttatttttatctaaaatccgatggaacttatgctaaccaagagtggcaaaaagtgggc
ggcaaatggtactatttcaagaagtggggctatatggctcggaatgagtggcaaggcaac
tactatttgactggaagtggtgccatggcgactgacgaagtgattatggatggtgctcgc
tatatctttgcggcctctggtgagctcaaagaaaagaaagatttgaatgtcggctgggtt
cacagagatggtaaacgctatttctttaataatagagaagaacaagtgggaaccgaacat
gctaagaaaatcattgatattagtgagcacaatggtcgtatcaatgattggaaaaaggtt
attgatgagaacaaggtggatggtgtcattgttcgtctaggttatagcggtaaagaagac
aaggaattggcgcataacattaaggagttaaaccgtctgggaattccttatggtgtctat
ctctatacctatgctgaaaatgagaccgatgctgagaatgacgctaaacagaccattgaa
cttataaagaaatacaatatgaacctgtcttaccctatctattatgatgttgagaactgg
gaatatgtaaataagagcaagagagctccaagtgatacagacacttgggttaaaatcatc
aacaagtacatggacacgatgaagcaggcgggttatcaaaatgtatatgtctatagctat
cgtagtttattacagacgcgtttaaaacacccagatattttaaaacatgtaaactgggta
gcggcctatacgaatgctttagaatgggaaaacccttattattcaggagaaaaaggttgg
caatatacctcttctgaatacatgaaaggaatccaagggcgcgtagatgtcagcgtttgg
tattaa

DBGET integrated database retrieval system