KEGG   Streptococcus pneumoniae R6 (avirulent): spr1432Help
Entry
spr1432           CDS       T00060                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00010  Glycolysis / Gluconeogenesis
spr00051  Fructose and mannose metabolism
spr00562  Inositol phosphate metabolism
spr01100  Metabolic pathways
spr01110  Biosynthesis of secondary metabolites
spr01120  Microbial metabolism in diverse environments
spr01130  Biosynthesis of antibiotics
spr01200  Carbon metabolism
spr01230  Biosynthesis of amino acids
Module
spr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spr1432 (tpiA)
   00051 Fructose and mannose metabolism
    spr1432 (tpiA)
   00562 Inositol phosphate metabolism
    spr1432 (tpiA)
Enzymes [BR:spr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     spr1432 (tpiA)
Exosome [BR:spr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   spr1432 (tpiA)
  Exosomal proteins of bladder cancer cells
   spr1432 (tpiA)
  Exosomal proteins of melanoma cells
   spr1432 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 933104
NCBI-ProteinID: NP_359025
UniProt: P66943
Structure
PDB: 

Jmol
Position
complement(1416054..1416833)
Genome map
AA seq 259 aa AA seqDB search
MKKEVCEMSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLA
VAKGSNLKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKK
AKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAI
GTGKSASQDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGAL
VGGASLEAESFLALLDFVK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagaggtatgtgaaatgtcacgtaaaccatttatcgctggtaactggaaaatg
aacaaaaatccagaagaagctaaagcattcgttgaagcagttgcatcaaaacttccttca
tcagatcttgttgaagcaggtatcgctgctccagctcttgatttgacaactgttcttgct
gttgcaaaaggctcaaaccttaaagttgctgctcaaaactgctactttgaaaatgcaggt
gctttcactggtgaaactagcccacaagttttgaaagaaatcggtactgactacgttgtt
atcggtcactcagaacgccgtgactacttccatgaaactgacgaagatatcaacaaaaaa
gcaaaagcaatctttgcgaacggtatgcttccaatcatctgttgtggtgaatcacttgaa
acttacgaagctggtaaagctgctgaattcgtaggtgctcaagtatctgctgcattggct
ggattgactgctgaacaagttgctgcctcagttatcgcttatgagccaatctgggctatc
ggtactggtaaatcagcttcacaagacgatgcacaaaaaatgtgtaaagttgttcgtgac
gttgtagctgctgactttggtcaagaagtcgcagacaaagttcgtgttcaatacggtggt
tctgttaaacctgaaaatgttgcttcatacatggcttgcccagacgttgacggtgccctt
gtaggtggtgcgtcacttgaagctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system