KEGG   Streptococcus pneumoniae R6 (avirulent): spr1432Help
Entry
spr1432           CDS       T00060                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    spr1432 (tpiA)
   01230 Biosynthesis of amino acids
    spr1432 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spr1432 (tpiA)
   00051 Fructose and mannose metabolism
    spr1432 (tpiA)
   00562 Inositol phosphate metabolism
    spr1432 (tpiA)
Enzymes [BR:spr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     spr1432 (tpiA)
Exosome [BR:spr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   spr1432 (tpiA)
  Exosomal proteins of bladder cancer cells
   spr1432 (tpiA)
  Exosomal proteins of melanoma cells
   spr1432 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1416054..1416833)
Genome map
AA seq 259 aa AA seqDB search
MKKEVCEMSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLA
VAKGSNLKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKK
AKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAI
GTGKSASQDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGAL
VGGASLEAESFLALLDFVK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagaggtatgtgaaatgtcacgtaaaccatttatcgctggtaactggaaaatg
aacaaaaatccagaagaagctaaagcattcgttgaagcagttgcatcaaaacttccttca
tcagatcttgttgaagcaggtatcgctgctccagctcttgatttgacaactgttcttgct
gttgcaaaaggctcaaaccttaaagttgctgctcaaaactgctactttgaaaatgcaggt
gctttcactggtgaaactagcccacaagttttgaaagaaatcggtactgactacgttgtt
atcggtcactcagaacgccgtgactacttccatgaaactgacgaagatatcaacaaaaaa
gcaaaagcaatctttgcgaacggtatgcttccaatcatctgttgtggtgaatcacttgaa
acttacgaagctggtaaagctgctgaattcgtaggtgctcaagtatctgctgcattggct
ggattgactgctgaacaagttgctgcctcagttatcgcttatgagccaatctgggctatc
ggtactggtaaatcagcttcacaagacgatgcacaaaaaatgtgtaaagttgttcgtgac
gttgtagctgctgactttggtcaagaagtcgcagacaaagttcgtgttcaatacggtggt
tctgttaaacctgaaaatgttgcttcatacatggcttgcccagacgttgacggtgccctt
gtaggtggtgcgtcacttgaagctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system