KEGG   Streptococcus pneumoniae R6 (avirulent): spr1632Help
Entry
spr1632           CDS       T00060                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00260  Glycine, serine and threonine metabolism
spr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spr01100  Metabolic pathways
spr01110  Biosynthesis of secondary metabolites
spr01130  Biosynthesis of antibiotics
spr01230  Biosynthesis of amino acids
Module
spr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    spr1632 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    spr1632 (trpB)
Enzymes [BR:spr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     spr1632 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 933618
NCBI-ProteinID: NP_359224
UniProt: Q8DNM8
Structure
PDB: 

Jmol
Position
complement(1605311..1606534)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECIIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSTLGPHPFPEIVRDFQSVIGREAKQQYRDLTGQNLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGAEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaagaaccaaataaagatggattttacggaaaatttggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctaccgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccaacttttgcgccagtatgtgggacgtgaaact
cccctttactacgcaaaaaacttgacccagcatatcggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttaggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaacgggtgctggtcagcacggt
gtggcaactgcaactgctgcagccctctttaatatggaatgtatcatctacatgggtgag
gaagatgtcaaacgccaagctctcaatgtcttccgtatggagcttttgggagctaaggtc
gaggccgtgacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtagctaatatcgatgatacccactatatccttggttctaccttggggcctcatcca
tttccagaaatcgttcgtgacttccaaagtgtcatcggtcgagaggctaaacaacagtac
cgtgacttgacaggacaaaatctgccagatgccctagtagcctgtgttggtggtgggtcg
aatgccatcggtctcttccatccctttgtagaagatgagtctgtagctatgtatggggct
gaagcagctggacttggtgtggatacggagcaccacgcagctaccttgaccaagggtcgt
ccaggtgtccttcacggttccctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagccttggaatctagccatgctatc
gcttttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtctgccta
tcaggtcgtggggacaaggatgtggttcaagtcaaagaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system