KEGG   Streptococcus pneumoniae R6 (avirulent): spr1709Help
Entry
spr1709           CDS       T00060                                 

Gene name
gtfA
Definition
sucrose phosphorylase (EC:2.4.1.5)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    spr1709 (gtfA)
Enzymes [BR:spr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     spr1709 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1680991..1682433)
Genome map
AA seq 480 aa AA seqDB search
MPIQNKTMLITYSDSLGNNLKDLYDNLEEHFGDAIGGVHLLPFFPSTGDRGFAPVDYDEV
DSAFGDWEDVKRLGERYYLMFDFMINHISRQSKYYKDYQEKHEASEFKALFLNWDKFWPE
NRPTQSDVDLIYKRKDRAPKQEIVFEDGSVEHLWNTFGEEQIDLDVTKEVTMEFIRKTIQ
HLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKVRDIAAEYGTELLPEIHEHYS
IQFKIADHDYYVYDFALPMVTLYTLYSSRTERLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEIDYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDVKYFLARLI
QAFAPGIPQVYYVGLLAGKNDLKLLEETKEGRNINRHYYSNEEIAKEVQRPVVKALLNLF
SFRNRSEAFDLEGTTEIETPTAHSIVIKRQNKDKSVTAVVEIDLQNQTYRVIENGVEVTF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcaaaataaaaccatgttgattacctattctgatagccttggaaataatctt
aaagacttatatgataatttggaagagcattttggagatgctattggaggagttcacctt
ttaccatttttcccatcaacaggtgatcgtggatttgcgccagttgactacgacgaagtg
gactcagcttttggtgattgggaggatgttaagcgtttaggtgagagatattatcttatg
tttgattttatgattaatcatatttctcgtcaatccaagtattataaggactatcaagaa
aaacatgaagccagtgaatttaaagctctctttttaaactgggataagttttggccagaa
aaccgtccgacacagtctgatgtagatttaatttacaagcgtaaggatcgtgcaccaaag
caagagattgtgtttgaagatggttcagtggaacatttgtggaatacctttggtgaggag
cagattgatcttgatgtgaccaaagaagtaactatggaatttatccgtaagaccattcag
cacttggcaagtaatgggtgtgatttgattcgtctagatgcctttgcttatgcagtgaag
aaattggatactaatgatttctttgtggaaccagatatttgggatttattggacaaagtt
cgagatatcgctgctgagtatgggacagagcttttacctgagattcatgaacactattcg
attcagtttaaaatagcagaccatgattactatgtttatgattttgctcttccaatggtg
acactttatactctttacagttccagaacagagcgtttggctaagtggttaaagatgagc
ccgatgaagcaatttacgacgctagatacccatgatgggattggagtagtagatgtcaag
gatatcctgaccgatgaggagattgactatgcttcaaatgaactctataaggttggagcc
aatgtcaaacgtaagtactctagtgccgagtataacaacttagatatctaccaaatcaat
tcaacctactattcagcgcttggagatgatgatgtcaagtattttctcgctcgtctaatt
caagcttttgccccaggtattcctcaggtttactatgtgggtctattagcaggcaagaat
gacttgaaattattagaagaaactaaagaaggtcgaaatattaatcgtcattactatagc
aacgaggaaatagcaaaagaagtgcaacgacctgttgtgaaggcccttctcaatctattt
tctttccgtaaccgttcagaagcctttgatctagaggggactactgagatagagacacca
acagctcacagcattgtaatcaaacgtcaaaataaagataagtccgtaacagcagtagta
gaaattgatttgcaaaatcagacttatcgggtaattgagaatggagttgaagtaacattt
tga

DBGET integrated database retrieval system