KEGG   Streptococcus pneumoniae R6 (avirulent): spr1713Help
Entry
spr1713           CDS       T00060                                 

Gene name
aga
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:spr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:spr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1685869..1688031)
Genome map
AA seq 720 aa AA seqDB search
MGVRIENNLFYVESKNLSLIIENRNGYLLLKHLGKTIKNYKGSNSVYERDHAFSGNPTAT
NRTFSLDTQRQIFGQHGLGDFRKPTIQVQHSVTEVTDFRFVEAKILKGQNGPQGLPSPHS
MDDTETLVLMLEDSKAQLSLTLYYTTFNNDATIASYSKLDNNSNQEVVIHKDFSFMADFP
AADYEIVTLQGAYAREKTVRRQQVEQGIFSISSNRGASGHAQTPALLLCEQGVTEDAGNV
FAIQLMYSGNFEAFVQKNQLNEVRVAIGINPENFSWKLAPEEYFETPVALVTHSDQGLTG
ISHESQNFVLKHIILSEFSKKERPILINNWEATYFDFQREKLLELADEAKKVGIELFVLD
DGWFGNRFDDNRALGDWVVNEEKLGGSLESLISAIHERGLQFGLWLEPEMISVDSDLYRQ
HPDWAIQVPDYEHTYSRNQLVLNLANPQVVEYLKSVLDQLLSYHEIDYIKWDMNRNITKL
GNGLTYLETQMQSHQYMLGLYELVSYLTEKHSHILFESCSGGGGRNDLGMIRYFPQVWAS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMGRMTPLETRGHVAMMGNLGYELDL
TNLSDEEKATIANQVNLYKELRPVVQLGQQYRLINPDTASNEAAVQFNYGNQTIVTYVRV
LSVVETMETTLKLKDLDEEGLYKLQENGEVYSGAELMYAGLTVILSQGDFLSRQYIFRKL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggagttaggatagagaataatctattttatgttgagagtaaaaatctaagtttgatt
attgaaaatcgaaatggctacttacttttgaaacatttaggaaagactattaagaactat
aaaggttccaatagtgtttatgaacgagaccatgccttttcaggaaatccaacggctact
aatcgaacctttagtttagatactcagcgacagatttttggacaacatggcttaggagat
tttaggaaaccaactatacaggttcagcatagtgtaactgaagtaacagactttcgattt
gtagaagcaaagattttaaaaggtcagaatggtccacagggcttaccttctccacatagc
atggacgatacagagactcttgtcttaatgttagaagattctaaggctcaacttagtctg
actttgtattatactacttttaataatgatgcgactattgctagctacagtaaattagat
aataatagtaatcaggaagttgtcatccataaagatttttcttttatggctgattttcca
gctgcagattacgaaatagtaactctgcagggtgcttatgctcgtgaaaagactgttaga
cgtcaacaggtagaacaaggaatcttttcgattagttcaaaccgaggtgcttctggtcat
gctcaaacaccagctcttctactatgcgaacaaggagtcacagaggatgctgggaatgtg
tttgctattcaactaatgtatagtggcaactttgaagcttttgttcaaaaaaatcaattg
aatgaagttcgggtggctattggcattaatccagaaaacttttcttggaagttagcccct
gaggaatactttgaaacaccggtagctttagtgactcattcagatcagggattaactggt
attagtcatgaaagtcagaattttgtactgaagcacattattctaagtgaattttctaaa
aaagaacgtccaattctaatcaataactgggaagctacttactttgactttcagagagaa
aaactgttagagttagcagatgaagctaagaaagttggcattgaactttttgtattagat
gatggttggtttggcaatcgttttgatgataatcgtgctttaggtgattgggttgttaat
gaggaaaaactgggtggaagtctagaaagtctgatttcagctatccatgaaagaggtttg
cagtttggactttggttagaacccgaaatgatttctgtagatagtgatttgtatcgtcaa
catcctgactgggctattcaggttcctgattatgagcatacttattctcggaatcaatta
gtacttaatcttgccaatcctcaggtagtagaatacttgaaaagtgtcttagatcaactc
ctatcttatcatgagattgattacattaaatgggatatgaaccgcaatatcactaagcta
gggaatggattaacttatctagagacacagatgcaatctcatcagtacatgctgggactt
tacgaactcgtttcttatctgacagagaagcacagccatattctctttgagtcctgctct
ggtggtggtggacgaaatgatcttggtatgatacgctatttcccacaagtctgggctagt
gataatactgatgccattgcacgtttaccaattcaatacggttcatcctatctctatcca
accatttctatgggggctcatgtgtcagcagtaccgaatcatcagatgggacgaatgaca
ccattagaaacacgtggccatgtagcaatgatgggaaatttgggctatgagcttgatttg
acaaatttatcagatgaagagaaagctacgattgctaatcaggtgaacttgtataaagaa
ttacgaccagtagttcagttaggacagcagtatagactaattaatcctgatactgcatcc
aatgaagcagctgtacaatttaattacggaaatcaaacgattgtaacctacgttcgcgtt
ttatctgttgtagagaccatggaaacaactttaaaattaaaagatttggatgaagaggga
ctatataaattacaggaaaatggcgaagtttactcaggtgcagaactaatgtatgcgggc
ttaactgttatcttatcccaaggagattttttgagtagacagtatatttttagaaaacta
tga

DBGET integrated database retrieval system