KEGG   Streptococcus pneumoniae R6 (avirulent): spr1837Help
Entry
spr1837           CDS       T00060                                 

Gene name
adhE
Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00010  Glycolysis / Gluconeogenesis
spr00620  Pyruvate metabolism
spr00625  Chloroalkane and chloroalkene degradation
spr00626  Naphthalene degradation
spr00650  Butanoate metabolism
spr01100  Metabolic pathways
spr01110  Biosynthesis of secondary metabolites
spr01120  Microbial metabolism in diverse environments
spr01130  Biosynthesis of antibiotics
spr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    spr1837 (adhE)
   00620 Pyruvate metabolism
    spr1837 (adhE)
   00650 Butanoate metabolism
    spr1837 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    spr1837 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    spr1837 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    spr1837 (adhE)
   00626 Naphthalene degradation
    spr1837 (adhE)
Enzymes [BR:spr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     spr1837 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     spr1837 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 AdoMet_dc
Motif
Other DBs
NCBI-GeneID: 933809
NCBI-ProteinID: NP_359429
UniProt: Q8DNA5
Position
complement(1811697..1814369)
Genome map
AA seq 890 aa AA seqDB search
MKAMEENMADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLNQEQVDYIVAKASVAA
LDAHGELALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAE
PVGVVCGITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGA
PENCVQWITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVE
KSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALL
EEFCFGVKANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLT
REKLSPVIAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVIC
NSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLP
SKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEP
DPDITTVNRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRK
RAFKFPLLGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPAL
VLTVPGFVAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSR
EKMHNASTIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTA
TWPKYNYYRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEK
EWKEHSRELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagctatggaggaaaatatggctgataaaaaaactgtgacaccagaggaaaagaaa
ctcgttgctgaaaagcacgtagatgagttggttcaaaaagctctagttgcccttgaagaa
atgcgtaaattgaatcaagagcaagttgactacatcgttgccaaagcatcagtagcagct
ttggatgcccatggagaattggctttacatgcctttgaagaaacaggacgtggtgtattt
gaagataaagcaactaagaacttgtttgcttgtgaacacgtagtaaacaacatgcgccac
actaagacagttggtgttatcgaagaagacgatgtaacaggattgactcttattgctgaa
ccagttggtgttgtttgtggtattactccaacaacaaacccaacatcaacagcaatcttc
aaatcattgatttcattgaagacacgtaacccaatcgtctttgccttccatccatcagca
caagaatcatctgctcatgcagctcgtatcgtccgcgatgcagctatcgcagctggtgct
cctgaaaactgtgtgcaatggattactcaaccatctatggaagcaacaagtgcccttatg
aaccacgaaggtgttgcgacaatccttgcaacaggtggtaatgccatggttaaagccgca
tactcatgtggtaaaccagctcttggggtaggtgccggaaacgttccagcttatgttgaa
aaatcagcaaacattcgtcaagcagcacacgatatcgtcatgtctaaatcatttgataac
ggtatggtctgtgcatctgaacaagcagttatcattgataaagaaatttacgatgaattt
gtagcagagttcaaatcttaccacacttactttgtaaacaaaaaagaaaaagctcttctt
gaagagttctgcttcggcgtcaaagcaaacagcaaaaactgtgctggtgcaaaattgaac
gctgacatcgttggtaaaccagcaacttggattgcagaacaagcaggatttacagttcca
gaaggaacaaacattcttgctgcagaatgtaaagaagttggcgaaaatgagccattgact
cgtgaaaaattgtcaccagttattgcagttttgaaatctgaaagccgtgaagatggtatt
actaaggctcgtcaaatggttgaatttaacggtcttggacactcagcagctatccacaca
gctgacgaagaattgactaaagaatttggtaaagctgttaaagctattcgtgttatctgt
aactcaccttctacttttggtggtatcggggacgtttacaatgccttcttgccatcattg
acacttggatgtggttcttacggacgcaactcagttggggataacgttagtgccattaac
ctcttgaatatcaaaaaagtcggaagacggagaaataacatgcaatggatgaaacttcct
tcaaaaacatactttgaacgtgattcaattcaataccttcaaaaatgtcgtgacgttgaa
cgtgtcatgatcgttactgaccatgccatggtagagcttggtttccttgatcgtatcatc
gaacaactggaccttcgtcgcaataaggttgtttaccaaatctttgcggatgtagaaccg
gatccagatatcacaactgtaaaccgtggtactgagattatgcgtgccttcaaaccagat
accatcatcgcactcggtggtgggtctccaatggatgctgccaaagtaatgtggctcttc
tacgagcaaccagaagtggacttccgtgaccttgtccaaaaattcatggatatccgtaaa
cgtgccttcaagttcccattgcttggtaagaagactaaattcatcgcgattccaactaca
tctggtacaggatctgaagtaacaccatttgccgttatctctgataaagcaaacaaccgt
aaatacccaatcgctgactactcattgacaccaactgtggcaatcgtagatcctgctttg
gtattgacagttccaggatttgttgctgctgatactggtatggacgtattgactcacgcg
acagaagcatacgtatcacaaatggctagtgactacactgatggtttagcacttcaagcc
attaaattggtctttgaaaatctcgaaagctcagttaagaatgcagacttccactcacgt
gagaaaatgcataacgcttcaacaatcgctggtatggcctttgccaatgccttcctaggt
atttctcactcaatggcccataagattggtgcgcaattccacacaatccacggtcgtaca
aatgctatcttgcttccatacgttatccgttacaacggtacacgtccagctaagacagca
acatggcctaagtacaactactaccgtgcagatgaaaaataccaagatatcgcacgcatg
cttggacttccagcttctactccagaagaaggggttgaatcttacgcaaaagctgtctac
gaactcggtgaacgtattgggatccaaatgaattttagagaccaaggaattgacgaaaaa
gaatggaaagaacattctcgtgaattagccttcctggcttatgaagaccaatgttcacca
gctaacccacgtcttccaatggtagaccatatgcaagaaatcatcgaagatgcatactat
ggctacaaagaaagaccaggacgccgtaaataa

DBGET integrated database retrieval system