KEGG   Streptococcus pneumoniae R6 (avirulent): spr1903Help
Entry
spr1903           CDS       T00060                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    spr1903 (galU)
   00052 Galactose metabolism
    spr1903 (galU)
   00500 Starch and sucrose metabolism
    spr1903 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    spr1903 (galU)
Enzymes [BR:spr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     spr1903 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1880756..1881655
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYKRTHASTIAVMPVPHDEVSAYGVIAPQ
GEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFQILENQAPGAGNEIQLTDAID
TLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYLIQLGKELTEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagttatccctgctgctggactaggaactcgattttta
ccagcaaccaaggcccttgccaaagaaatgttgccaatcgtagacaaaccaactatccag
tttatcgtggaagaggctctcaaatcaggtattgaagatattctagttgtcactggtaaa
tcaaaacgttctattgaggaccacttcgattcaaacttcgaattggaatataacctcaaa
gaaaaagggaaaacagatcttttgaagctagttgatgaaacaactggcatgcgtctgcat
tttatccgccaaactcatccacgcggtctcggagatgctgttttgcaagccaaggctttc
gtcggaaatgaaccttttgtcgttatgcttggtgatgacttgatggatatcacagacgaa
aaggctgttccacttaccaaacaactcatggatgactacaagcgtacccacgcgtctact
atcgctgtcatgccagtccctcatgacgaagtatctgcttacggggttattgctccgcaa
ggcgaaggaaaagatggtctttacagtgttgaaacctttgttgaaaaaccagctccagag
gacgctcctagcgaccttgctattatcggacgctacctcctcacgcctgaaattttccaa
atcctcgaaaaccaagctcctggtgctggaaatgaaatccaacttactgatgcaatcgat
actcttaataaaacacagcgtgtttttgcccgtgaatttacaggagctcgttacgacgtt
ggggataagtttggctttatgaaaacatctattgactacgccctcaaacatccacaagtc
aaagatgatttgaagaattacctcatccaacttggaaaagaattgactgagaaggaataa

DBGET integrated database retrieval system