KEGG   Streptococcus pneumoniae R6 (avirulent): spr1909Help
Entry
spr1909           CDS       T00060                                 

Gene name
pbp1b
Definition
(RefSeq) penicillin-binding protein 1B
  KO
K03693  
penicillin-binding protein 1B
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Peptidoglycan biosynthesis
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    spr1909 (pbp1b)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    spr1909 (pbp1b)
Glycosyltransferases [BR:spr01003]
 Polysaccharide
  Bacterial polysaccharide
   spr1909 (pbp1b)
Peptidoglycan biosynthesis and degradation proteins [BR:spr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   spr1909 (pbp1b)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1886036..1888501)
Genome map
AA seq 821 aa AA seqDB search
MQNQLNELKRKMLEFFQQKQKNKKSARPGKKGSSTKKSKTLDKSAIFPAILLSIKALFNL
LFVLGFLGGMLGAGIALGYGVALFDKVRVPQTEELVNQVKDISSISEITYSDGTVIASIE
SDLLRTSISSEQISENLKKAIIATEDEHFKEHKGVVPKAVIRATLGKFVGLGSSSGGSTL
TQQLIKQQVVGDAPTLARKAAEIVDALALERAMNKDEILTTYLNVAPFGRNNKGQNIAGA
RQAAEGIFGVDASQLTVPQAAFLAGLPQSPITYSPYENTGELKSDEDLEIGLRRAKAVLY
SMYRTGALSKDEYSQYKDYDLKQDFLPSGTVTGISRDYLYFTTLAEAQERMYDYLAQRDN
VSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRV
EVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSE
TILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYME
KMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEY
QDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDEN
MWLMLSTPRLTLGGWIGHDDNHSLSRRAGYSNNSNYMAHLVNAIQQASPSIWGNERFALD
PSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQ
NAWSSIVGSLPTPSSSSSSSSSSSDSSNSSTTRPSSSRARR
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaattaaatgaattaaaacgaaaaatgctggaatttttccagcaaaaacaa
aaaaataaaaaatcagctagacctggcaagaaaggttcaagtaccaaaaaatctaaaacc
ttagataagtcagccattttcccagctattttactgagtataaaagccttatttaactta
ctctttgtactcggttttctaggaggaatgttgggagctgggattgctttggggtacgga
gtggccttatttgacaaggttcgggtgcctcagacagaagaattggtgaatcaggtcaag
gacatctcttctatttcagagattacctattcggacgggacggtgattgcttccatagag
agtgatttgttgcgcacttctatctcatctgagcaaatttcggaaaatctgaagaaggct
atcattgcgacagaagatgaacactttaaagaacataagggtgtagtacccaaggcggtg
attcgtgcgaccttggggaaatttgtaggtttgggttcctctagtgggggttcaaccttg
acccagcaactaattaaacagcaggtggttggggatgcgccgaccttggctcgtaaggcg
gcagagattgtggatgctcttgccttggaacgcgccatgaataaagatgagattttaacg
acctatctcaatgtggctccctttggccgaaataataagggacagaatattgcaggggct
cggcaagcagctgagggaattttcggtgtagatgccagtcagttgactgttcctcaagca
gcatttttagcaggacttccacagagtcccattacttactctccttatgaaaatactggg
gagttgaagagtgatgaagacctagaaattggcttaagacgggctaaggcagttctttac
agtatgtatcgtacaggtgcattaagcaaagacgagtattctcagtacaaggattatgac
cttaaacaggactttttaccatcgggcacggttacaggaatttcacgagactatttatac
tttacaactttggcagaagctcaagaacgtatgtatgactatctagctcagagagacaat
gtctccgctaaggagttgaaaaatgaggcaactcagaagttttatcgagatttggcagcc
aaggaaattgaaaatggtggttataagattactactaccatagatcagaaaattcattct
gccatgcaaagtgcggttgctgattatggctatcttttagacgatggaacaggtcgtgta
gaagtagggaatgtcttgatggacaaccaaacaggtgctattctaggctttgtaggtggt
cgtaattatcaagaaaatcaaaataatcatgcctttgataccaaacgttcgccagcttct
actaccaagcccttgctggcctacggtattgctattgaccagggcttgatgggaagtgaa
acgattctatctaactatccaacaaactttgctaatggcaatccgattatgtatgctaat
agcaagggaacaggaatgatgaccttgggagaagctctgaactactcatggaatatccct
gcttactggacctatcgtatgctccgtgaaaatggtgttgatgtcaagggttatatggaa
aagatgggttacgagattcctgagtacggtattgagagcttgccaatgggtggtggtatt
gaagtcacagttgcccagcataccaatggctatcagaccttagctaataatggagtttat
catcagaagcatgtgatttcaaagattgaagcagcagatggtagagtggtgtatgagtat
caggataaaccggttcaagtctattcaaaagctactgcgacgattatgcagggattgcta
cgagaagttctatcctctcgtgtgacaacaaccttcaagtctaacctgacttctttaaat
cctactctggctaatgcagattggattgggaagactggtacaaccaaccaagacgaaaat
atgtggctcatgctttcgacacctagattaaccctaggtggctggattgggcatgatgat
aatcattcattgtcacgtagagcaggttattctaataactctaattacatggctcatctg
gtaaatgcgattcagcaagcttccccaagcatttgggggaacgagcgctttgctttagat
cctagtgtagtgaaatcggaagtcttgaaatcaacaggtcaaaaaccagggaaggtttct
gttgaaggaaaagaggtagaggtcacaggttcgactgttaccagctattgggctaataag
tcaggagcgccagcgacaagttatcgctttgctattggcggaagtgatgcggattatcag
aatgcttggtctagtattgtggggagtctaccaactccatccagctccagcagttcaagt
agtagttctagcgatagcagtaactcaagtactacacgaccttcttcttcaagggcgaga
cgataa

DBGET integrated database retrieval system